PDB entry 3mpm

View 3mpm on RCSB PDB site
Description: LCK complexed with a pyrazolopyrimidine
Class: Transferase
Keywords: Kinase domain, Transferase
Deposited on 2010-04-27, released 2010-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.172
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase Lck
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239
      • engineered (129)
    Domains in SCOPe 2.06: d3mpma_
  • Heterogens: 5LK, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpmA (A:)
    gpewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkq
    lqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmaf
    ieernyihrnlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainy
    gtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmr
    lcwkerpedrptfdylrsvledfftat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpmA (A:)
    wevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlqh
    qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee
    rnyihrnlraanilvsdtlsckiadfglarliedneytarfpikwtapeainygtftiks
    dvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerp
    edrptfdylrsvledff