PDB entry 3mpl

View 3mpl on RCSB PDB site
Description: Crystal Structure of Bordetella pertussis BvgS VFT2 domain (Double Mutant F375E/Q461E)
Class: signaling protein
Keywords: venus flytrap, sensor domain, signaling protein
Deposited on 2010-04-27, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virulence sensor protein bvgS
    Species: Bordetella pertussis [TaxId:257313]
    Gene: BP1877, bvgS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16575
      • engineered mutation (99)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3mpla_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mplA (A:)
    mrgshhhhhhgsldfahpaysareqqwmadhpvvkvavlnlfapftlfrtdeqfggisaa
    vlqllqlrtgldfeiigvdtveeliaklrsgeadmagalevnsaresflsfsrpyvrngm
    vivtrqdpdapvdadhldgrtvalvrnsaaipllqrrypqakvvtadnpseamlmvangq
    adavvetqisasyyvnryfagklriasaldlppaeialattrgqtelmsilnkalysisn
    delasiisrwrgsdgdprtwyayrnei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mplA (A:)
    hpaysareqqwmadhpvvkvavlnlfapftlfreqfggisaavlqllqlrtgldfeiigv
    dtveeliaklrsgeadmagalevnsaresflsfsrpyvrngmvivtrqdpdapvdadhld
    grtvalvrnsaaipllqrrypqakvvtadnpseamlmvangqadavvetqisasyyvnry
    fagklriasaldlppaeialattrgqtelmsilnkalysisndelasiisrwr