PDB entry 3mpk

View 3mpk on RCSB PDB site
Description: Crystal Structure of Bordetella pertussis BvgS periplasmic VFT2 domain
Class: signaling protein
Keywords: venus flytrap, sensor domain, signaling protein
Deposited on 2010-04-27, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virulence sensor protein bvgS
    Species: Bordetella pertussis [TaxId:257313]
    Gene: BP1877, bvgS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpka_
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpkA (A:)
    mrgshhhhhhgsldfahpaysareqqwmadhpvvkvavlnlfapftlfrtdeqfggisaa
    vlqllqlrtgldfeiigvdtveeliaklrsgeadmagalfvnsaresflsfsrpyvrngm
    vivtrqdpdapvdadhldgrtvalvrnsaaipllqrrypqakvvtadnpseamlmvangq
    adavvqtqisasyyvnryfagklriasaldlppaeialattrgqtelmsilnkalysisn
    delasiisrwrgsdgdprtwyayrnei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpkA (A:)
    hpaysareqqwmadhpvvkvavlnlfapftlfrtdeqfggisaavlqllqlrtgldfeii
    gvdtveeliaklrsgeadmagalfvnsaresflsfsrpyvrngmvivtrqdpdapvdadh
    ldgrtvalvrnsaaipllqrrypqakvvtadnpseamlmvangqadavvqtqisasyyvn
    ryfagklriasaldlppaeialattrgqtelmsilnkalysisndelasiisrwr