PDB entry 3mph

View 3mph on RCSB PDB site
Description: The structure of human diamine oxidase complexed with an inhibitor aminoguanidine
Deposited on 2010-04-27, released 2010-09-08
The last revision was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amiloride-sensitive amine oxidase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19801 (Start-730)
      • see remark 999 (571)
      • see remark 999 (624)
  • Chain 'B':
    Compound: Amiloride-sensitive amine oxidase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19801 (Start-730)
      • see remark 999 (571)
      • see remark 999 (624)
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mphA (A:)
    rspgtlprkagvfsdlsnqelkavhsflwskkelrlqpsstttmakntvfliemllpkky
    hvlrfldkgerhpvrearaviffgdqehpnvtefavgplpgpcymralsprpgyqsswas
    rpistaeyallyhtlqeatkplhqfflnttgfsfqdchdrclaftdvaprgvasgqrrsw
    liiqryvegyflhptglellvdhgstdaghwaveqvwyngkfygspeelarkyadgevdv
    vvledplpggkghdsteepplfsshkprgdfpspihvsgprlvqphgprfrlegnavlyg
    gwsfafrlrsssglqvlnvhfggeriayevsvqeavalygghtpagmqtkyldvgwglgs
    vthelapgidcpetatfldtfhyydaddpvhypralclfemptgvplrrhfnsnfkggfn
    fyaglkgqvlvlrttstvynxdyiwdfifypngvmeakmhatgyvhatfytpeglrhgtr
    lhthlignihthlvhyrvdldvagtknsfqtlqmklenitnpwsprhrvvqptleqtqys
    werqaafrfkrklpkyllftspqenpwghkrsyrlqihsmadqvlppgwqeeqaitwary
    plavtkyreselcsssiyhqndpwdppvvfeqflhnnenienedlvawvtvgflhiphse
    dipntatpgnsvgfllrpfnffpedpslasrdtvivwprdngpnyvqrwipedrdcsmpp
    pfsyngtyrpv
    

    Sequence, based on observed residues (ATOM records):
    >3mphA (A:)
    rkagvfsdlsnqelkavhsflwskkelrlqpsstttmakntvfliemllpkkyhvlrfld
    kgerhpvrearaviffgdqehpnvtefavgplpgpcymralsprpgyqsswasrpistae
    yallyhtlqeatkplhqfflnttgfsfqdchdrclaftdvaprgvasgqrrswliiqryv
    egyflhptglellvdhgstdaghwaveqvwyngkfygspeelarkyadgevdvvvledpl
    epplfsshkprgdfpspihvsgprlvqphgprfrlegnavlyggwsfafrlrsssglqvl
    nvhfggeriayevsvqeavalygghtpagmqtkyldvgwglgsvthelapgidcpetatf
    ldtfhyydaddpvhypralclfemptgvplrrhfnsnfkggfnfyaglkgqvlvlrttst
    vynxdyiwdfifypngvmeakmhatgyvhatfytpeglrhgtrlhthlignihthlvhyr
    vdldvagtknsfqtlqmklenitnpwsprhrvvqptleqtqyswerqaafrfkrklpkyl
    lftspqenpwghkrsyrlqihsmadqvlppgwqeeqaitwaryplavtkyreselcsssi
    yhqndpwdppvvfeqflhnnenienedlvawvtvgflhiphsedipntatpgnsvgfllr
    pfnffpedpslasrdtvivwprdngpnyvqrwipedrdcsmpppfsyngtyrpv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mphB (B:)
    rspgtlprkagvfsdlsnqelkavhsflwskkelrlqpsstttmakntvfliemllpkky
    hvlrfldkgerhpvrearaviffgdqehpnvtefavgplpgpcymralsprpgyqsswas
    rpistaeyallyhtlqeatkplhqfflnttgfsfqdchdrclaftdvaprgvasgqrrsw
    liiqryvegyflhptglellvdhgstdaghwaveqvwyngkfygspeelarkyadgevdv
    vvledplpggkghdsteepplfsshkprgdfpspihvsgprlvqphgprfrlegnavlyg
    gwsfafrlrsssglqvlnvhfggeriayevsvqeavalygghtpagmqtkyldvgwglgs
    vthelapgidcpetatfldtfhyydaddpvhypralclfemptgvplrrhfnsnfkggfn
    fyaglkgqvlvlrttstvynxdyiwdfifypngvmeakmhatgyvhatfytpeglrhgtr
    lhthlignihthlvhyrvdldvagtknsfqtlqmklenitnpwsprhrvvqptleqtqys
    werqaafrfkrklpkyllftspqenpwghkrsyrlqihsmadqvlppgwqeeqaitwary
    plavtkyreselcsssiyhqndpwdppvvfeqflhnnenienedlvawvtvgflhiphse
    dipntatpgnsvgfllrpfnffpedpslasrdtvivwprdngpnyvqrwipedrdcsmpp
    pfsyngtyrpv
    

    Sequence, based on observed residues (ATOM records):
    >3mphB (B:)
    rkagvfsdlsnqelkavhsflwskkelrlqpsstttmakntvfliemllpkkyhvlrfld
    kgerhpvrearaviffgdqehpnvtefavgplpgpcymralsprpgyqsswasrpistae
    yallyhtlqeatkplhqfflnttgfsfqdchdrclaftdvaprgvasgqrrswliiqryv
    egyflhptglellvdhgstdaghwaveqvwyngkfygspeelarkyadgevdvvvleppl
    fsshkprgdfpspihvsgprlvqphgprfrlegnavlyggwsfafrlrsssglqvlnvhf
    ggeriayevsvqeavalygghtpagmqtkyldvgwglgsvthelapgidcpetatfldtf
    hyydaddpvhypralclfemptgvplrrhfnsnfkggfnfyaglkgqvlvlrttstvynx
    dyiwdfifypngvmeakmhatgyvhatfytpeglrhgtrlhthlignihthlvhyrvdld
    vagtknsfqtlqmklenitnpwsprhrvvqptleqtqyswerqaafrfkrklpkyllfts
    pqenpwghkrsyrlqihsmadqvlppgwqeeqaitwaryplavtkyreselcsssiyhqn
    dpwdppvvfeqflhnnenienedlvawvtvgflhiphsedipntatpgnsvgfllrpfnf
    fpedpslasrdtvivwprdngpnyvqrwipedrdcsmpppfsyngtyrpv