PDB entry 3mpg

View 3mpg on RCSB PDB site
Description: dihydroorotase from bacillus anthracis
Deposited on 2010-04-26, released 2010-11-10
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3739, BA_4027, GBAA_4027, pyrC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: dihydroorotase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3739, BA_4027, GBAA_4027, pyrC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mpgA (A:)
    mnylfkngrymneegkivatdllvqdgkiakvaenitadnaevidvngkliapglvdvhv
    hlrepggehketietgtlaaakggftticampntrpvpdcrehmedlqnrikekahvnvl
    pygaitvrqagsemtdfetlkelgafaftddgvgvqdasmmlaamkraaklnmavvahce
    entlinkgcvhegkfsekhglngipsvcesvhiardillaeaadchyhvchvstkgsvrv
    irdakragikvtaevtphhlvlceddipsadpnfkmnpplrgkedhealieglldgtidm
    iatdhaphtaeekaqgierapfgitgfetafpllytnlvkkgiitleqliqfltekpadt
    fgleagrlkegrtaditiidleqeeeidpttflskgkntpfagwkcqgwpvmtivggkia
    wqkesalv
    

    Sequence, based on observed residues (ATOM records):
    >3mpgA (A:)
    mnylfkngrymneegkivatdllvqdgkiakvaenitadnaevidvngkliapglvdvhv
    hlrepggehketietgtlaaakggftticampntrpvpdcrehmedlqnrikekahvnvl
    pygaitvrqagsemtdfetlkelgafaftddgvgvqdasmmlaamkraaklnmavvahce
    entlinkgcvhegkfsekhglngipsvcesvhiardillaeaadchyhvchvstkgsvrv
    irdakragikvtaevtphhlvlceddipsadpnfkmnpplrgkedhealieglldgtidm
    iatdhaphtaeekaqgierapfgitgfetafpllytnlvkkgiitleqliqfltekpadt
    fgleagrlkegrtaditiidleqeeeidpttflskgkntpfagwkcqgwpvmtivggkia
    wqkesa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mpgB (B:)
    mnylfkngrymneegkivatdllvqdgkiakvaenitadnaevidvngkliapglvdvhv
    hlrepggehketietgtlaaakggftticampntrpvpdcrehmedlqnrikekahvnvl
    pygaitvrqagsemtdfetlkelgafaftddgvgvqdasmmlaamkraaklnmavvahce
    entlinkgcvhegkfsekhglngipsvcesvhiardillaeaadchyhvchvstkgsvrv
    irdakragikvtaevtphhlvlceddipsadpnfkmnpplrgkedhealieglldgtidm
    iatdhaphtaeekaqgierapfgitgfetafpllytnlvkkgiitleqliqfltekpadt
    fgleagrlkegrtaditiidleqeeeidpttflskgkntpfagwkcqgwpvmtivggkia
    wqkesalv
    

    Sequence, based on observed residues (ATOM records):
    >3mpgB (B:)
    mnylfkngrymneegkivatdllvqdgkiakvaenitadnaevidvngkliapglvdvhv
    hlrepggehketietgtlaaakggftticampntrpvpdcrehmedlqnrikekahvnvl
    pygaitvrqagsemtdfetlkelgafaftddgvgvqdasmmlaamkraaklnmavvahce
    entlinkgcvhegkfsekhglngipsvcesvhiardillaeaadchyhvchvstkgsvrv
    irdakragikvtaevtphhlvlceddipsadpnfkmnpplrgkedhealieglldgtidm
    iatdhaphtaeekaqgierapfgitgfetafpllytnlvkkgiitleqliqfltekpadt
    fgleagrlkegrtaditiidleqeeeidpttflskgkntpfagwkcqgwpvmtivggkia
    wqkesa