PDB entry 3mpf

View 3mpf on RCSB PDB site
Description: Crystal structure of human Cathepsin-S C25S mutant with bound drug
Class: hydrolase
Keywords: CatS, Cathepsin S, pyrazole, Diazinones, P3, HYDROLASE
Deposited on 2010-04-26, released 2010-06-30
Made obsolete by 5qbv on 2017-12-20

The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (0-216)
      • engineered (24)
      • expression tag (217-218)
    Domains in SCOPe 2.07: d3mpfa1, d3mpfa2
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (0-216)
      • engineered (24)
    Domains in SCOPe 2.07: d3mpfb_
  • Heterogens: N2D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpfA (A:)
    lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypeila
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpfB (B:)
    lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypeila
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpfB (B:)
    lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei