PDB entry 3mpd

View 3mpd on RCSB PDB site
Description: Crystal structure of nucleoside diphosphate kinase from encephalitozoon cuniculi, cubic form, apo
Class: transferase
Keywords: SSGCID, NIH, NIAID, SBRI, UW, EMERALD BIOSTRUCTURES, ENCEPHALITOZOON CUNICULI, KINASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2010-04-26, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.177
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Gene: ECU06_1530, HM-1:IMSS, NDK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpda_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Gene: ECU06_1530, HM-1:IMSS, NDK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpdb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpdA (A:)
    gpgsmertfimikpdaikrrlisriiqrfeekglylaaskcvipkrevlethyshlssmp
    ffsemvedmmsgmvlamvwvgkdavsigrkligetnpqaasvgtirgdygvstgkniihg
    sdcvenaekeiklwigddvqpvsffdkewiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpdA (A:)
    mertfimikpdaikrrlisriiqrfeekglylaaskcvipkrevlethyshlssmpffse
    mvedmmsgmvlamvwvgkdavsigrkligetnpqaasvgtirgdygvstgkniihgsdcv
    enaekeiklwigddvqpvsffdkewiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpdB (B:)
    gpgsmertfimikpdaikrrlisriiqrfeekglylaaskcvipkrevlethyshlssmp
    ffsemvedmmsgmvlamvwvgkdavsigrkligetnpqaasvgtirgdygvstgkniihg
    sdcvenaekeiklwigddvqpvsffdkewiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpdB (B:)
    mertfimikpdaikrrlisriiqrfeekglylaaskcvipkrevlethyshlssmpffse
    mvedmmsgmvlamvwvgkdavsigrkligetnpqaasvgtirgdygvstgkniihgsdcv
    enaekeiklwigddvqpvsffdkewiy