PDB entry 3mpb

View 3mpb on RCSB PDB site
Description: Z5688 from E. coli O157:H7 bound to fructose
Deposited on 2010-04-26, released 2010-07-21
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sugar isomerase
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs5070, Z5688
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sugar isomerase
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs5070, Z5688
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, ACT, FRU, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mpbA (A:)
    mgsshhhhhhssglvprgsmkrsaindilghtrqffsqhdvhlppfasfspaqwqqldta
    aweevfdlklgwdvtafgrnnfaahgltlftlrngsakgmpyvkcyaekimhvrdaqvtp
    mhfhwrkrediinrgggnlivelwnadsneqtadsditvvidgcrqkhtagsqlrlspge
    siclppglyhsfwaeagfgdvlvgevssvndddhdnhflqpldrynlidedepaqlvlcn
    eyrqfr
    

    Sequence, based on observed residues (ATOM records):
    >3mpbA (A:)
    mkrsaindilghtrqffsqhdvhlppfasfspaqwqqldtaaweevfdlklgwdvtafgr
    nnfaahgltlftlrngsakgmpyvkcyaekimhvrdaqvtpmhfhwrkrediinrgggnl
    ivelwnadsneqtadsditvvidgcrqkhtagsqlrlspgesiclppglyhsfwaeagfg
    dvlvgevssvndddhdnhflqplrynlidedepaqlvlcneyrqfr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mpbB (B:)
    mgsshhhhhhssglvprgsmkrsaindilghtrqffsqhdvhlppfasfspaqwqqldta
    aweevfdlklgwdvtafgrnnfaahgltlftlrngsakgmpyvkcyaekimhvrdaqvtp
    mhfhwrkrediinrgggnlivelwnadsneqtadsditvvidgcrqkhtagsqlrlspge
    siclppglyhsfwaeagfgdvlvgevssvndddhdnhflqpldrynlidedepaqlvlcn
    eyrqfr
    

    Sequence, based on observed residues (ATOM records):
    >3mpbB (B:)
    mkrsaindilghtrqffsqhdvhlppfasfspaqwqqldtaaweevfdlklgwdvtafgr
    nnfaahgltlftlrngsakgmpyvkcyaekimhvrdaqvtpmhfhwrkrediinrgggnl
    ivelwnadsneqtadsditvvidgcrqkhtagsqlrlspgesiclppglyhsfwaeagfg
    dvlvgevssvndddhdnhflqpldrynlidedepaqlvlcneyrqfr