PDB entry 3mp8

View 3mp8 on RCSB PDB site
Description: crystal structure of sgf29 tudor domain
Deposited on 2010-04-26, released 2011-05-04
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein,LINKER,SAGA-associated factor 29
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: SGF29
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (1-361)
      • initiating methionine (0)
    • PDB 3MP8 (362-374)
    • Uniprot P25554 (375-End)
  • Heterogens: MAL, GOL, SO4, NA, ACY, 4BZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mp8A (A:)
    mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
    alaaaqtnaaaefgssywtseynpnapilvgsevaykprrgsadgewiqcevlkvvadgt
    rfevrdpepdelgnsgkvykcnrkelllippgfptknyppgtkvlarypetttfypaivi
    gtkrdgtcrlrfdgeeevdketevtrrlvlpsptalanlark
    

    Sequence, based on observed residues (ATOM records):
    >3mp8A (A:)
    mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
    alaaaqtnaaaefgssywtseynpnapilvgsevaykprrgsadgewiqcevlkvvadgt
    rfevrdpepdelgnsgkvykcnrkelllippgfptknyppgtkvlarypetttfypaivi
    gtkrdgtcrlrfdgeeevdketevtrrlvlpsp