PDB entry 3mp7

View 3mp7 on RCSB PDB site
Description: Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes
Class: protein transport
Keywords: Protein Transport, Membrane Protein Complex, Preprotein Translocase, Membrane Insertion, Structural Genomics, PSI-2, Protein Structure Initiative, Center for Structures of Membrane Proteins, CSMP
Deposited on 2010-04-26, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase subunit secY
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: SECY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U019 (Start-467)
      • expression tag (468-469)
    Domains in SCOPe 2.07: d3mp7a1, d3mp7a2
  • Chain 'B':
    Compound: Preprotein translocase subunit secE
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: secE
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mp7A (A:)
    mgardiiyalerwfpeverpkrrvplrerfmwtgvalilyyvlaeipvygiperiqdyfq
    flrvvlagrngsiltlgigpivtagiilqllvgseiikldlanpedrrfyqalqrvfsvf
    mcffeaavwilggafgrvgvdvtyaiavlmilqlamggivliildelvskwgigsgislf
    iaagvsqtiltrslnpltdpniidpltgqpaivgaipyfiqhilkgdlwgaiyrggsapd
    mlsvvativvffivvyfesmrveiplgyrgvtvrgsypirflyvsnipiiltfalyaniq
    lwarvldrlghpwlgrfdpttgspisgfvlyvipprnifsvidnpvraivyliltvifsl
    lfgylwveltgldarsiarqlqraglqipgfrrdprtlekvlqryipyvtfwgsltvali
    avladflgalgtgtgilltvgilyrfyeeiareqitemfpalrklfgagtlvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mp7A (A:)
    lrerfmwtgvalilyyvlaeipvygiperiqdyfqflrvvlagrngsiltlgigpivtag
    iilqlqrvfsvfmcffeaavwilggafgrvaiavlmilqlamggivliildelvskwgig
    sgislfiaagvsqtiltrslnpltdpnpltgqpaivgaipyfiqhilkgdlwgaiyrggs
    apdmlsvvativvffivvyfesmrveiypirflyvsnipiiltfalyaniqlwarvldrl
    ghpwlgrfdpttgspisgfvlyvipprnifsvidnpvraivyliltvifsllfgylwvel
    tgldarsiaripgfrrdprtlekpyvtfwgsltvaliavladflgalgtgtgilltvgil
    yrfyeeiareqitemfpalrklfgagt
    

  • Chain 'B':
    No sequence available.