PDB entry 3mp5

View 3mp5 on RCSB PDB site
Description: Crystal Structure of Human Lyase R41M in complex with HMG-CoA
Deposited on 2010-04-24, released 2010-06-16
The last revision was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: HMGCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35914 (0-End)
      • engineered (13)
  • Chain 'B':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: HMGCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35914 (0-End)
      • engineered (13)
  • Chain 'C':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: HMGCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35914 (0-End)
      • engineered (13)
  • Chain 'D':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: HMGCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35914 (0-End)
      • engineered (13)
  • Chain 'E':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: HMGCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35914 (0-End)
      • engineered (13)
  • Chain 'F':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: HMGCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35914 (0-End)
      • engineered (13)
  • Heterogens: HMG, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mp5A (A:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatckl
    

    Sequence, based on observed residues (ATOM records):
    >3mp5A (A:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatc
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mp5B (B:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatckl
    

    Sequence, based on observed residues (ATOM records):
    >3mp5B (B:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatc
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mp5C (C:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatckl
    

    Sequence, based on observed residues (ATOM records):
    >3mp5C (C:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglgsgn
    latedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatc
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mp5D (D:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatckl
    

    Sequence, based on observed residues (ATOM records):
    >3mp5D (D:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatc
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mp5E (E:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatckl
    

    Sequence, based on observed residues (ATOM records):
    >3mp5E (E:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatc
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mp5F (F:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    yaqgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatckl
    

    Sequence, based on observed residues (ATOM records):
    >3mp5F (F:)
    tlpkrvkivevgpmdglqneknivstpvkiklidmlseaglsviettsfvspkwvpqmgd
    htevlkgiqkfpginypvltpnlkgfeaavaagakevvifgaaselftkknincsieesf
    qrfdailkaaqsanisvrgyvscalgcpyegkispakvaevtkkfysmgcyeislgdtig
    vgtpgimkdmlsavmqevplaalavhchdtygqalantlmalqmgvsvvdssvaglggcp
    qgasgnlatedlvymleglgihtgvnlqklleagnficqalnrktsskvaqatc