PDB entry 3mp2

View 3mp2 on RCSB PDB site
Description: Crystal structure of transmissible gastroenteritis virus papain-like protease 1
Deposited on 2010-04-24, released 2010-09-08
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural protein 3
    Species: Porcine transmissible gastroenteritis coronavirus [TaxId:11151]
    Gene: 1a
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mp2A (A:)
slppfkttnlngkiilkqgdnncwinaccyqlqafdffnneawekfkkgdvmdfvnlcya
attlarghsgdaeyllelmlndystakivlaakcgcgekeivleravfkltplkesfnyg
vcgdcmqvntcrflsvegsgvfvhdilskqtpeamfvvkpvmhavytgttqnghymvddi
ehgycvdgmgikplkkrcytstlfinanvmt