PDB entry 3moy

View 3moy on RCSB PDB site
Description: Crystal structure of probable enoyl-CoA hydratase from Mycobacterium smegmatis
Class: lyase
Keywords: SSGCID, Seattle Structural Genomics Center for Infectious Disease, enoyl CoA, Actinobacteria, LYASE
Deposited on 2010-04-23, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable enoyl-CoA hydratase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_6777
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3moya_
  • Heterogens: SO4, TRS, EDO, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3moyA (A:)
    gpgsmttyttiatsrpvagvglirldrpdalnalnqtleaevldaardfdadleigaivv
    tgserafaagadiaemvtltphqarernllsgwdsltqvrkpivaavagyalgggcelam
    lcdlviaadtarfgqpeitlgilpglggtqrltravgkakamdlcltgrsltaeeaervg
    lvsrivpaadlldealavaqriarmsrpagravkdaineaferplsagmryerdafyamf
    dthdqtegmtaflekrtpeftdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3moyA (A:)
    ttyttiatsrpvagvglirldrpdalnalnqtleaevldaardfdadleigaivvtgser
    afaagadiaemvtltphqarernllsgwdsltqvrkpivaavagyalgggcelamlcdlv
    iaadtarfgqpeitlgilpglggtqrltravgkakamdlcltgrsltaeeaervglvsri
    vpaadlldealavaqriarmsrpagravkdaineaferplsagmryerdafyamfdthdq
    tegmtaflekrtpeftdr