PDB entry 3mow

View 3mow on RCSB PDB site
Description: Crystal structure of SHP2 in complex with a tautomycetin analog TTN D-1
Class: hydrolase/hydrolase inhibitor
Keywords: natural product, catalytic domain, inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-04-23, released 2011-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP2C, PTPN11, SHPTP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mowa_
  • Heterogens: B2B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mowA (A:)
    mlysrkegqrqenknknryknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnn
    skpkksyiatqgclqntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkey
    gvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfle
    evhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsq
    rsgmvqteaqyrfiymavqhyietlqrrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mowA (A:)
    lysrkegqrqenknknryknilpfdhtrvvlhdgdpnepvsdyinaniimpeksyiatqg
    clqntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesa
    ahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimda
    gpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyr
    fiymavqhyietlq