PDB entry 3mos

View 3mos on RCSB PDB site
Description: The structure of human Transketolase
Deposited on 2010-04-23, released 2010-07-28
The last revision was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Homo sapiens [TaxId:9606]
    Gene: TKT
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TPP, CA, EDO, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mosA (A:)
    syhkpdqqklqalkdtanrlrissiqattaagsghptsccsaaeimavlffhtmryksqd
    prnphndrfvlskghaapilyavwaeagflaeaellnlrkissdldghpvpkqaftdvat
    gslgqglgaacgmaytgkyfdkasyrvycllgdgelsegsvweamafasiykldnlvail
    dinrlgqsdpaplqhqmdiyqkrceafgwhaiivdghsveelckafgqakhqptaiiakt
    fkgrgitgvedkeswhgkplpknmaeqiiqeiysqiqskkkilatppqedapsvdianir
    mpslpsykvgdkiatrkaygqalaklghasdriialdgdtknstfseifkkehpdrfiec
    yiaeqnmvsiavgcatrnrtvpfcstfaafftrafdqirmaaisesninlcgshcgvsig
    edgpsqmaledlamfrsvptstvfypsdgvatekavelaantkgicfirtsrpenaiiyn
    nnedfqvgqakvvlkskddqvtvigagvtlhealaaaellkkekinirvldpftikpldr
    klildsaratkgriltvedhyyeggigeavssavvgepgitvthlavnrvprsgkpaell
    kmfgidrdaiaqavrg