PDB entry 3mor

View 3mor on RCSB PDB site
Description: Crystal structure of Cathepsin B from Trypanosoma Brucei
Class: hydrolase
Keywords: Thiol Protease, HYDROLASE
Deposited on 2010-04-23, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.204
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin B-like cysteine protease
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.6.560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mora_
  • Chain 'B':
    Compound: Cathepsin B-like cysteine protease
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.6.560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3morb_
  • Heterogens: GOL, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3morA (A:)
    lvaedapvlskafvdrvnrlnrgiwkakydgvmqnitlreakrlngvikknnnasilpkr
    rfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfctmggvqd
    vhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhskskngyp
    pcsqfnfdtpkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevafdvyedf
    iaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflirrgssec
    giedggsagiplapnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3morA (A:)
    silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct
    mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk
    skngyppcsqfnfdtpkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf
    dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir
    rgssecgiedggsagiplap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3morB (B:)
    lvaedapvlskafvdrvnrlnrgiwkakydgvmqnitlreakrlngvikknnnasilpkr
    rfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfctmggvqd
    vhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhskskngyp
    pcsqfnfdtpkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevafdvyedf
    iaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflirrgssec
    giedggsagiplapnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3morB (B:)
    silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct
    mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk
    skngyppcsqfnfdtpkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf
    dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir
    rgssecgiedggsagiplap