PDB entry 3moq

View 3moq on RCSB PDB site
Description: amyloid beta(18-41) peptide fusion with new antigen receptor variable domain from sharks
Deposited on 2010-04-23, released 2011-02-16
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: New antigen receptor variable domain,P3(40) peptide from Amyloid beta A4 protein,New antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6X1E6 (0-86)
    • Uniprot P05067 (87-110)
      • linker (111)
    • Uniprot Q6X1E6 (112-123)
      • expression tag (124-125)
  • Chain 'B':
    Compound: New antigen receptor variable domain,P3(40) peptide from Amyloid beta A4 protein,New antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6X1E6 (0-86)
    • Uniprot P05067 (87-110)
      • linker (111)
    • Uniprot Q6X1E6 (112-123)
      • expression tag (124-125)
  • Chain 'C':
    Compound: New antigen receptor variable domain,P3(40) peptide from Amyloid beta A4 protein,New antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6X1E6 (0-86)
    • Uniprot P05067 (87-110)
      • linker (111)
    • Uniprot Q6X1E6 (112-123)
      • expression tag (124-125)
  • Chain 'D':
    Compound: New antigen receptor variable domain,P3(40) peptide from Amyloid beta A4 protein,New antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6X1E6 (0-86)
    • Uniprot P05067 (87-110)
      • linker (111)
    • Uniprot Q6X1E6 (112-123)
      • expression tag (124-125)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3moqA (A:)
    awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
    kgsksfslrisdlrvedsgtykcqafyvffaedvgsnkgaiiglmvggvviggekgagta
    ltvkaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3moqB (B:)
    awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
    kgsksfslrisdlrvedsgtykcqafyvffaedvgsnkgaiiglmvggvviggekgagta
    ltvkaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3moqC (C:)
    awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
    kgsksfslrisdlrvedsgtykcqafyvffaedvgsnkgaiiglmvggvviggekgagta
    ltvkaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3moqD (D:)
    awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
    kgsksfslrisdlrvedsgtykcqafyvffaedvgsnkgaiiglmvggvviggekgagta
    ltvkaa