PDB entry 3mop

View 3mop on RCSB PDB site
Description: the ternary death domain complex of myd88, irak4, and irak2
Deposited on 2010-04-23, released 2010-06-02
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (1-98)
      • expression tag (0)
      • expression tag (99-104)
  • Chain 'B':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (1-98)
      • expression tag (0)
      • expression tag (99-104)
  • Chain 'C':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (1-98)
      • expression tag (0)
      • expression tag (99-104)
  • Chain 'D':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (1-98)
      • expression tag (0)
      • expression tag (99-104)
  • Chain 'E':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (1-98)
      • expression tag (0)
      • expression tag (99-104)
  • Chain 'F':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (1-98)
      • expression tag (0)
      • expression tag (99-104)
  • Chain 'G':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWZ3 (2-104)
      • expression tag (0-1)
      • expression tag (105-106)
  • Chain 'H':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWZ3 (2-104)
      • expression tag (0-1)
      • expression tag (105-106)
  • Chain 'I':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWZ3 (2-104)
      • expression tag (0-1)
      • expression tag (105-106)
  • Chain 'J':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWZ3 (2-104)
      • expression tag (0-1)
      • expression tag (105-106)
  • Chain 'K':
    Compound: Interleukin-1 receptor-associated kinase-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IRAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43187 (0-End)
      • engineered mutation (48)
  • Chain 'L':
    Compound: Interleukin-1 receptor-associated kinase-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IRAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43187 (0-End)
      • engineered mutation (48)
  • Chain 'M':
    Compound: Interleukin-1 receptor-associated kinase-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IRAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43187 (0-End)
      • engineered mutation (48)
  • Chain 'N':
    Compound: Interleukin-1 receptor-associated kinase-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IRAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43187 (0-End)
      • engineered mutation (48)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mopA (A:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopA (A:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaaleh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mopB (B:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopB (B:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaaleh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mopC (C:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopC (C:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaaleh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mopD (D:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopD (D:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaaleh
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mopE (E:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopE (E:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaaleh
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mopF (F:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopF (F:)
    mlplaalnmrvrrrlslflnvrtqvaadwtalaeemdfeyleirqletqadptgrlldaw
    qgrpgasvgrllelltklgrddvllelgpsieedcqkyiaaaleh
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mopG (G:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopG (G:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavple
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mopH (H:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopH (H:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavple
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3mopI (I:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopI (I:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavple
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3mopJ (J:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mopJ (J:)
    mgpitpstyvrclnvglirklsdfidpqegwkklavaikkpsgddrynqfhirrfeallq
    tgksptsellfdwgttnctvgdlvdlliqneffapaslllpdavple
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3mopK (K:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwkpapeircpipafpdsvkp
    

    Sequence, based on observed residues (ATOM records):
    >3mopK (K:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwk
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3mopL (L:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwkpapeircpipafpdsvkp
    

    Sequence, based on observed residues (ATOM records):
    >3mopL (L:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwk
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3mopM (M:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwkpapeircpipafpdsvkp
    

    Sequence, based on observed residues (ATOM records):
    >3mopM (M:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwk
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >3mopN (N:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwkpapeircpipafpdsvkp
    

    Sequence, based on observed residues (ATOM records):
    >3mopN (N:)
    acyiyqlpswvlddlcrnmdalsewdwmefasyvitdltqlrkiksmewvqgvsitrell
    wwwgmrqatvqqlvdllcrlelyraaqiilnwk