PDB entry 3moo

View 3moo on RCSB PDB site
Description: Crystal structure of the HmuO, heme oxygenase from Corynebacterium diphtheriae, in complex with azide-bound verdoheme
Class: oxidoreductase
Keywords: heme oxygenase, reaction intermediate, ferrous verdoheme, reaction mechanism, anaerobic chamber, absorption spectra, OXIDOREDUCTASE
Deposited on 2010-04-22, released 2011-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.182
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mooa_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3moob_
  • Heterogens: SUC, VEA, AZI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mooA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mooA (A:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mooB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mooB (B:)
    ataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdav
    rasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgp
    alvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnl
    elsdeqrehllkeatdafvfnhqvfadlg