PDB entry 3mon

View 3mon on RCSB PDB site
Description: crystal structures of two intensely sweet proteins
Class: sweet-tasting protein
Keywords: sweet-tasting protein
Deposited on 1992-08-26, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02881 (0-43)
  Domains in SCOPe 2.05: d3mon.5
• Chain 'B':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02882 (0-48)
  Domains in SCOPe 2.05: d3mon.5
• Chain 'C':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02881 (0-43)
  Domains in SCOPe 2.05: d3mon.6
• Chain 'D':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02882 (0-48)
  Domains in SCOPe 2.05: d3mon.6
• Chain 'E':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02881 (0-43)
  Domains in SCOPe 2.05: d3mon.7
• Chain 'F':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02882 (0-48)
  Domains in SCOPe 2.05: d3mon.7
• Chain 'G':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02881 (0-43)
  Domains in SCOPe 2.05: d3mon.8
• Chain 'H':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02882 (0-48)
  Domains in SCOPe 2.05: d3mon.8

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monA (A:)
  reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monB (B:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monC (C:)
  reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monD (D:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monE (E:)
  reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monF (F:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monG (G:)
  reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3monH (H:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene