PDB entry 3mom

View 3mom on RCSB PDB site
Description: structure of holo hasap h32a mutant complexed with imidazole from pseudomonas aeruginosa to 2.25a resolution
Deposited on 2010-04-22, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme acquisition protein HasAp
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: hasAp, PA14_20020
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Heme acquisition protein HasAp
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: hasAp, PA14_20020
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IMD, HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3momA (A:)
    msisisysttysgwtvadyladwsayfgdvnarpgqvvdgsntggfnpgpfdgsqyalks
    tasdaafiaggdlhytlfsnpshtlwgkldsialgdtltggassggyaldsqevsfsnlg
    ldspiaqgrdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvaha
    tpaa
    

    Sequence, based on observed residues (ATOM records):
    >3momA (A:)
    sisisysttysgwtvadyladwsayfgdgqvvdgsntggfnpgpfdgsqyalkstasdaa
    fiaggdlhytlfsnpshtlwgkldsialgdtltggassggyaldsqevsfsnlgldspia
    qgrdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvahat
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3momB (B:)
    msisisysttysgwtvadyladwsayfgdvnarpgqvvdgsntggfnpgpfdgsqyalks
    tasdaafiaggdlhytlfsnpshtlwgkldsialgdtltggassggyaldsqevsfsnlg
    ldspiaqgrdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvaha
    tpaa
    

    Sequence, based on observed residues (ATOM records):
    >3momB (B:)
    sisisysttysgwtvadyladwsayfgdvvvdgsntggfnpgpfdgsqyalkstasdaaf
    iaggdlhytlfsnpshtlwgkldsialgdtltggassggyaldsqevsfsnlgldspiaq
    grdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvahatpa