PDB entry 3mol

View 3mol on RCSB PDB site
Description: Structure of dimeric holo HasAp H32A Mutant from Pseudomonas aeruginosa to 1.20A Resolution
Deposited on 2010-04-22, released 2010-07-28
The last revision was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.178
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme acquisition protein HasAp
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: hasAp, PA14_20020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02QP5 (Start-183)
      • engineered mutation (31)
  • Chain 'B':
    Compound: Heme acquisition protein HasAp
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: hasAp, PA14_20020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02QP5
      • engineered mutation (31)
  • Heterogens: HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3molA (A:)
    msisisysttysgwtvadyladwsayfgdvnarpgqvvdgsntggfnpgpfdgsqyalks
    tasdaafiaggdlhytlfsnpshtlwgkldsialgdtltggassggyaldsqevsfsnlg
    ldspiaqgrdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvaha
    tpaa
    

    Sequence, based on observed residues (ATOM records):
    >3molA (A:)
    sisisysttysgwtvadyladwsayfgdvnarpgqvvdgsntggfnpgpfdgsqyalkst
    asdaafiaggdlhytlfsnpshtlwgkldsialgdtltggassggyaldsqevsfsnlgl
    dspiaqgrdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvahat
    paa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3molB (B:)
    msisisysttysgwtvadyladwsayfgdvnarpgqvvdgsntggfnpgpfdgsqyalks
    tasdaafiaggdlhytlfsnpshtlwgkldsialgdtltggassggyaldsqevsfsnlg
    ldspiaqgrdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvaha
    tpaa
    

    Sequence, based on observed residues (ATOM records):
    >3molB (B:)
    sisisysttysgwtvadyladwsayfgdvnarpgqvvdgntggfnpgpfdgsqyalksta
    sdaafiaggdlhytlfsnpshtlwgkldsialgdtltgggyaldsqevsfsnlgldspia
    qgrdgtvhkvvyglmsgdssalqgqidallkavdpslsinstfdqlaaagvaha