PDB entry 3moi

View 3moi on RCSB PDB site
Description: The crystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50
Deposited on 2010-04-22, released 2010-05-26
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable dehydrogenase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4777, GI:33603750
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3moiA (A:)
    mkirfgicglgfagsvlmapamrhhpdaqivaacdpnedvrerfgkeygipvfatlaemm
    qhvqmdavyiasphqfhcehvvqaseqglhiivekpltlsrdeadrmieaveragvhlvv
    gtsrshdpvvrtlraivqegsvgrvsmlncfnytdflyrprrpeeldtskgggiiynqlp
    hqidsiktitgqritavramtgrldpkrptegncaamltledgacavmvysgydhfdsde
    mhfwlaeggrakqpnhggarkvlrqlegdeaelrrsrygfggpisksmesgntdrkqphf
    gvmlvtcehadlraspegvlvygdegvrevpaitgrgpfsqgdtidelrdaiagvapalr
    darwgkdtlevclavlessatgrqver
    

    Sequence, based on observed residues (ATOM records):
    >3moiA (A:)
    mkirfgicglgfagsvlmapamrhhpdaqivaacdpnedvrerfgkeygipvfatlaemm
    qhvqmdavyiasphqfhcehvvqaseqglhiivekpltlsrdeadrmieaveragvhlvv
    gtsrshdpvvrtlraivqegsvgrvsmlncfnytdflyrprrpeeldtskgggiiynqlp
    hqidsiktitgqritavramtgrldpkrptegncaamltledgacavmvysgydhfdsde
    mhfwlaeggrakqpnhggarkvlrqlegdeaelrrsrygfggpisksdrkqphfgvmlvt
    cehadlraspegvlvygdegvrevpaitgrgpfsqgdtidelrdaiagvapalrdarwgk
    dtlevclavlessatgrqver