PDB entry 3mog

View 3mog on RCSB PDB site
Description: Crystal structure of 3-hydroxybutyryl-CoA dehydrogenase from Escherichia coli K12 substr. MG1655
Deposited on 2010-04-22, released 2010-06-23
The last revision was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 3-hydroxybutyryl-CoA dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Gene: paaH, ydbU, b1395, JW1390
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Probable 3-hydroxybutyryl-CoA dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Gene: paaH, ydbU, b1395, JW1390
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Probable 3-hydroxybutyryl-CoA dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Gene: paaH, ydbU, b1395, JW1390
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76083 (3-End)
      • expression tag (2)
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mogA (A:)
    mslnvqtvavigsgtmgagiaevaashghqvllydisaealtraidgiharlnsrvtrgk
    ltaetcertlkrlipvtdihalaaadlvieaaserlevkkalfaqlaevcppqtllttnt
    ssisitaiaaeiknpervaglhffnpapvmklvevvsglataaevveqlceltlswgkqp
    vrchstpgfivnrvarpyyseawraleeqvaapevidaalrdgagfpmgpleltdligqd
    vnfavtcsvfnafwqerrflpslvqqelviggrlgkksglgvydwraereavvgleavsd
    sfspmkvekksdgvteiddvllietqgetaqalairlarpvvvidkmagkvvtiaaaavn
    pdsatrkaiyylqqqgktvlqiadypgmliwrtvamiinealdalqkgvaseqdidtamr
    lgvnypygplawgaqlgwqrilrllenlqhhygeeryrpcsllrqrallesgyeseghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3mogA (A:)
    nvqtvavigsgtmgagiaevaashghqvllydisaealtraidgiharlnsrvtrgklta
    etcertlkrlipvtdihalaaadlvieaaserlevkkalfaqlaevcppqtllttntssi
    sitaiaaeiknpervaglhffnpapvmklvevvsglataaevveqlceltlswgkqpvrc
    hstpgfivnrvarpyyseawraleeqvaapevidaalrdgagfpmgpleltdligqdvnf
    avtcsvfnafwqerrflpslvqqelviggrlgkksglgvydwraereavvgleavsdsfs
    pmkvekksdgvteiddvllietqgetaqalairlarpvvvidkmagkvvtiaaaavnpds
    atrkaiyylqqqgktvlqiadypgmliwrtvamiinealdalqkgvaseqdidtamrlgv
    nypygplawgaqlgwqrilrllenlqhhygeeryrpcsllrqrallesgy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mogB (B:)
    mslnvqtvavigsgtmgagiaevaashghqvllydisaealtraidgiharlnsrvtrgk
    ltaetcertlkrlipvtdihalaaadlvieaaserlevkkalfaqlaevcppqtllttnt
    ssisitaiaaeiknpervaglhffnpapvmklvevvsglataaevveqlceltlswgkqp
    vrchstpgfivnrvarpyyseawraleeqvaapevidaalrdgagfpmgpleltdligqd
    vnfavtcsvfnafwqerrflpslvqqelviggrlgkksglgvydwraereavvgleavsd
    sfspmkvekksdgvteiddvllietqgetaqalairlarpvvvidkmagkvvtiaaaavn
    pdsatrkaiyylqqqgktvlqiadypgmliwrtvamiinealdalqkgvaseqdidtamr
    lgvnypygplawgaqlgwqrilrllenlqhhygeeryrpcsllrqrallesgyeseghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3mogB (B:)
    nvqtvavigsgtmgagiaevaashghqvllydisaealtraidgiharlnsrvtrgklta
    etcertlkrlipvtdihalaaadlvieaaserlevkkalfaqlaevcppqtllttntssi
    sitaiaaeiknpervaglhffnpapvmklvevvsglataaevveqlceltlswgkqpvrc
    hstpgfivnrvarpyyseawraleeqvaapevidaalrdgagfpmgpleltdligqdvnf
    avtcsvfnafwqerrflpslvqqelviggrlgkksglgvydwraereavvgleavsdsfs
    pmkvekksdgvteiddvllietqgetaqalairlarpvvvidkmagkvvtiaaaavnpds
    atrkaiyylqqqgktvlqiadypgmliwrtvamiinealdalqkgvaseqdidtamrlgv
    nypygplawgaqlgwqrilrllenlqhhygeeryrpcsllrqrallesgy
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mogC (C:)
    mslnvqtvavigsgtmgagiaevaashghqvllydisaealtraidgiharlnsrvtrgk
    ltaetcertlkrlipvtdihalaaadlvieaaserlevkkalfaqlaevcppqtllttnt
    ssisitaiaaeiknpervaglhffnpapvmklvevvsglataaevveqlceltlswgkqp
    vrchstpgfivnrvarpyyseawraleeqvaapevidaalrdgagfpmgpleltdligqd
    vnfavtcsvfnafwqerrflpslvqqelviggrlgkksglgvydwraereavvgleavsd
    sfspmkvekksdgvteiddvllietqgetaqalairlarpvvvidkmagkvvtiaaaavn
    pdsatrkaiyylqqqgktvlqiadypgmliwrtvamiinealdalqkgvaseqdidtamr
    lgvnypygplawgaqlgwqrilrllenlqhhygeeryrpcsllrqrallesgyeseghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3mogC (C:)
    lnvqtvavigsgtmgagiaevaashghqvllydisaealtraidgiharlnsrvtrgklt
    aetcertlkrlipvtdihalaaadlvieaaserlevkkalfaqlaevcppqtllttntss
    isitaiaaeiknpervaglhffnpapvmklvevvsglataaevveqlceltlswgkqpvr
    chstpgfivnrvarpyyseawraleeqvaapevidaalrdgagfpmgpleltdligqdvn
    favtcsvfnafwqerrflpslvqqelviggrlgkksglgvydwraereavvgleavsdsf
    spmkvekksdgvteiddvllietqgetaqalairlarpvvvidkmagkvvtiaaaavnpd
    satrkaiyylqqqgktvlqiadypgmliwrtvamiinealdalqkgvaseqdidtamrlg
    vnypygplawgaqlgwqrilrllenlqhhygeeryrpcsllrqrallesgye