PDB entry 3moe

View 3moe on RCSB PDB site
Description: The structure of rat cytosolic PEPCK mutant A467G in complex with Beta-Sulfopyruvate and GTP
Class: lyase
Keywords: kinase, gluconeogenesis, lyase
Deposited on 2010-04-22, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PCK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07379 (2-623)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3moea1, d3moea2, d3moea3
  • Heterogens: GTP, MN, NA, SPV, 1PE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3moeA (A:)
    gsmppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrlla
    hmqeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwms
    eedfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgt
    svlealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggn
    sllgkkcfalriasrlakeegwlaehmlilgitnpegkkkylaaafpsacgktnlammnp
    tlpgwkvecvgddiawmkfdaqgnlrainpengffgvapgtsvktnpnaiktiqkntift
    nvaetsdggvywegideplapgvtitswknkewrpqdeepcahpnsrfctpasqcpiidp
    awespegvpiegiifggrrpagvplvyealswqhgvfvgaamrseatagaehkgkvimhd
    pfamrpffgynfgkylahwlsmahrpaaklpkifhvnwfrkdkngkflwpgfgensrvle
    wmfgriegedsakltpigyvpkedalnlkglgdvnveelfgiskefwekeveeidkyled
    qvnadlpyeierelralkqrisqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3moeA (A:)
    gsmppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrlla
    hmqeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwms
    eedfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgt
    svlealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggn
    sllgkkcfalriasrlakeegwlaehmlilgitnpegkkkylaaafpsacgktnlammnp
    tlpgwkvecvgddiawmkfdaqgnlrainpengffgvapgtsvktnpnaiktiqkntift
    nvaetsdggvywegideplapgvtitswknkewrpqdeepcahpnsrfctpasqcpiidp
    awespegvpiegiifggrrpagvplvyealswqhgvfvgaamrseatgkvimhdpfamrp
    ffgynfgkylahwlsmahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgri
    egedsakltpigyvpkedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadl
    pyeierelralkqrisqm