PDB entry 3mo8

View 3mo8 on RCSB PDB site
Description: pwwp domain of human bromodomain and phd finger-containing protein 1 in complex with trimethylated h3k36 peptide
Deposited on 2010-04-22, released 2010-06-02
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BR140, BRPF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55201 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: Histone H3.2 TRIMETHYLATED H3K36 PEPTIDE
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mo8A (A:)
    gedspldaldlvwakcrgypsypaliidpkmpregmfhhgvpipvpplevlklgeqmtqe
    arehlylvlffdnkrtwqwlprtklvplgvnqdldkekmlegrksnirksvqiayhralq
    hrskvqgeqs
    

    Sequence, based on observed residues (ATOM records):
    >3mo8A (A:)
    gedspldaldlvwakcrgypsypaliidpkmpregmfhhgvpipvpplevlklgeqmtqe
    arehlylvlffdnkrtwqwlprtklvplgvnqdldkekmlegrksnirksvqiayhralq
    hrskvqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mo8B (B:)
    patggvkkphry