PDB entry 3mo7

View 3mo7 on RCSB PDB site
Description: Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 2'-fluoro-6-iodo-UMP
Deposited on 2010-04-22, released 2011-04-06
The last revision was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.156
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine 5'-monophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: gi|13960142, OK/SW-cl.21, UMPS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: UFT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mo7A (A:)
    mgsshhhhhhssglvprgshmkelsfgaraelprihpvaskllrlmqkketnlclsadvs
    larellqladalgpsicmlkthvdilndftldvmkelitlakcheflifedrkfadignt
    vkkqyeggifkiaswadlvnahvvpgsgvvkglqevglplhrgclliaemsstgslatgd
    ytraavrmaeehsefvvgfisgsrvsmkpeflhltpgvqleaggdnlgqqynspqevigk
    rgsdiiivgrgiisaadrleaaemyrkaaweaylsrlgv
    

    Sequence, based on observed residues (ATOM records):
    >3mo7A (A:)
    kelsfgaraelprihpvaskllrlmqkketnlclsadvslarellqladalgpsicmlkt
    hvdilndftldvmkelitlakcheflifedrkfadigntvkkqyeggifkiaswadlvna
    hvvpgsgvvkglqevglplhrgclliaemsstgslatgdytraavrmaeehsefvvgfis
    gsrvsmkpeflhltpgvqleaggdnlgqqynspqevigkrgsdiiivgrgiisaadrlea
    aemyrkaaweaylsrlgv