PDB entry 3mo2

View 3mo2 on RCSB PDB site
Description: human G9a-like (GLP, also known as EHMT1) in complex with inhibitor E67
Class: transferase
Keywords: Epigenetics, Histone lysine methylation, enzymatic inhibition, lysine mimics, TRANSFERASE
Deposited on 2010-04-22, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mo2a_
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mo2b_
  • Chain 'C':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mo2c_
  • Chain 'D':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mo2d_
  • Heterogens: ZN, E67, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mo2A (A:)
    nsqvwsalqmskalqdsapdrpspverivsrdiargyeripipcvnavdsepcpsnykyv
    sqncvtspmnidrnithlqycvciddcsssncmcgqlsmrcwydkdgrllpefnmaeppl
    ifecnhacscwrncrnrvvqnglrarlqlyrtrdmgwgvrslqdippgtfvceyvgelis
    dseadvreedsylfdldnkdgevycidarfygnvsrfinhhcepnlvpvrvfmahqdlrf
    priaffstrlieageqlgfdygerfwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mo2A (A:)
    ivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvciddc
    sssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglrarl
    qlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldgevycidarf
    ygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfwdikg
    klfscrcgspkcrhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mo2B (B:)
    nsqvwsalqmskalqdsapdrpspverivsrdiargyeripipcvnavdsepcpsnykyv
    sqncvtspmnidrnithlqycvciddcsssncmcgqlsmrcwydkdgrllpefnmaeppl
    ifecnhacscwrncrnrvvqnglrarlqlyrtrdmgwgvrslqdippgtfvceyvgelis
    dseadvreedsylfdldnkdgevycidarfygnvsrfinhhcepnlvpvrvfmahqdlrf
    priaffstrlieageqlgfdygerfwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mo2B (B:)
    erivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvcid
    dcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglra
    rlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkevycid
    arfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfwd
    ikgklfscrcgspkcrhs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mo2C (C:)
    nsqvwsalqmskalqdsapdrpspverivsrdiargyeripipcvnavdsepcpsnykyv
    sqncvtspmnidrnithlqycvciddcsssncmcgqlsmrcwydkdgrllpefnmaeppl
    ifecnhacscwrncrnrvvqnglrarlqlyrtrdmgwgvrslqdippgtfvceyvgelis
    dseadvreedsylfdldnkdgevycidarfygnvsrfinhhcepnlvpvrvfmahqdlrf
    priaffstrlieageqlgfdygerfwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mo2C (C:)
    verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
    ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
    arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldgevycid
    arfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfwd
    ikgklfscrcgspkcrhs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mo2D (D:)
    nsqvwsalqmskalqdsapdrpspverivsrdiargyeripipcvnavdsepcpsnykyv
    sqncvtspmnidrnithlqycvciddcsssncmcgqlsmrcwydkdgrllpefnmaeppl
    ifecnhacscwrncrnrvvqnglrarlqlyrtrdmgwgvrslqdippgtfvceyvgelis
    dseadvreedsylfdldnkdgevycidarfygnvsrfinhhcepnlvpvrvfmahqdlrf
    priaffstrlieageqlgfdygerfwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mo2D (D:)
    erivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvcid
    dcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglra
    rlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldevycidar
    fygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfwdik
    gklfscrcgspkcrhs