PDB entry 3mnz

View 3mnz on RCSB PDB site
Description: crystal structure of the non-neutralizing hiv antibody 13h11 fab fragment with a gp41 mper-derived peptide bearing ala substitutions in a helical conformation
Deposited on 2010-04-22, released 2010-11-17
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-hiv-1 antibody 13h11 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MNZ (Start-107)
    • Uniprot Q8TCD0 (108-End)
  • Chain 'B':
    Compound: anti-hiv-1 antibody 13h11 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MNZ (Start-109)
    • Uniprot S6B291 (110-End)
  • Chain 'P':
    Compound: gp41 MPER-derived peptide
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MNZ
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mnzA (A:)
    rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
    iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrgecgs
    

    Sequence, based on observed residues (ATOM records):
    >3mnzA (A:)
    ldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfasi
    resgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mnzB (B:)
    lqiqlvqsgpelkkpgetvkisckasgytftdysvhwvkqvpgkglkwmgwintetgept
    yaddfkgrfafslessastayleihnlknedtatyfcalgwlhwglgttltvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdk
    

    Sequence, based on observed residues (ATOM records):
    >3mnzB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdysvhwvkqvpglkwmgwintetgeptyad
    dfkgrfafslessastayleihnlknedtatyfcalgwlhwglgttltvssastkgpsvf
    plapggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpsss
    lgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3mnzP (P:)
    aqaknaqelleldkwaslwn
    

    Sequence, based on observed residues (ATOM records):
    >3mnzP (P:)
    naqelleldkwaslwn