PDB entry 3mnn

View 3mnn on RCSB PDB site
Description: A Ruthenium Antitumour Agent Forms Specific Histone Protein Adducts in the Nucleosome Core
Class: structural protein/DNA
Keywords: NUCLEOSOME, NCP, RUTHENIUM, RAPTA-C, STRUCTURAL PROTEIN-DNA complex
Deposited on 2010-04-22, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • see remark 999 (101)
    Domains in SCOPe 2.07: d3mnna_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mnnb_
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A, LOC494591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mnnc_
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
    Domains in SCOPe 2.07: d3mnnd_
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • see remark 999 (101)
    Domains in SCOPe 2.07: d3mnne_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mnnf_
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A, LOC494591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mnng_
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
    Domains in SCOPe 2.07: d3mnnh_
  • Chain 'I':
    Compound: DNA (145-mer)
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: DNA (145-mer)
    Species: synthetic, synthetic
  • Heterogens: SO4, MG, RU, MML, PTW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mnnA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mnnB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnB (B:)
    vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
    vtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mnnC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnC (C:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mnnD (D:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnD (D:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mnnE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnE (E:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mnnF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnF (F:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mnnG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnG (G:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mnnH (H:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnnH (H:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.