PDB entry 3mnm

View 3mnm on RCSB PDB site
Description: Crystal structure of GAE domain of GGA2p from Saccharomyces cerevisiae
Deposited on 2010-04-21, released 2010-09-08
The last revision was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-binding protein GGA2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GGA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ADP-ribosylation factor-binding protein GGA2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GGA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ADP-ribosylation factor-binding protein GGA2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GGA2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mnmA (A:)
    slgtttapartlvnqspnlkiefeisresnsviriksfftnlssspisnlvfllavpksm
    slklqpqssnfmignakdgisqegtienapanpskalkvkwkvnysvnstqaeetavftl
    pnv
    

    Sequence, based on observed residues (ATOM records):
    >3mnmA (A:)
    artlvnqspnlkiefeisresnsviriksfftnlssspisnlvfllavpksmslklqpqs
    snfmignakdgisqegtienapanalkvkwkvnysvnstqaeetavftlpnv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mnmB (B:)
    slgtttapartlvnqspnlkiefeisresnsviriksfftnlssspisnlvfllavpksm
    slklqpqssnfmignakdgisqegtienapanpskalkvkwkvnysvnstqaeetavftl
    pnv
    

    Sequence, based on observed residues (ATOM records):
    >3mnmB (B:)
    artlvnqspnlkiefeisresnsviriksfftnlssspisnlvfllavpksmslklqpqs
    snfmignakdgisqegtienapanalkvkwkvnysvnstqaeetavftlpnv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mnmC (C:)
    slgtttapartlvnqspnlkiefeisresnsviriksfftnlssspisnlvfllavpksm
    slklqpqssnfmignakdgisqegtienapanpskalkvkwkvnysvnstqaeetavftl
    pnv
    

    Sequence, based on observed residues (ATOM records):
    >3mnmC (C:)
    partlvnqspnlkiefeisresnsviriksfftnlssspisnlvfllavpksmslklqpq
    ssnfmignakdgisqegtienaalkvkwkvnysvnstqaeetavftlpnv