PDB entry 3mne

View 3mne on RCSB PDB site
Description: Crystal structure of the agonist form of mouse glucocorticoid receptor stabilized by F608S mutation at 1.96A
Class: hormone receptor
Keywords: protein-ligand complex, steroid nuclear receptor, mouse, agonist, co-activator, HORMONE RECEPTOR
Deposited on 2010-04-21, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.153
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Nr3c1, Grl, Grl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06537 (4-260)
      • expression tag (3)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d3mnea1, d3mnea2
  • Chain 'B':
    Compound: Nuclear receptor coactivator 2 peptide
    Species: synthetic, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, DEX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mneA (A:)
    gshmvpaalpqltptlvslleviepevlyagydssvpdsawrimttlnmlggrqviaavk
    wakaipgfrnlhlddqmtllqyswmslmafalgwrsyrqasgnllcfapdliineqrmtl
    pcmydqckhmlfistelqrlqvsyeeylcmktllllssvpkeglksqelfdeirmtyike
    lgkaivkregnssqnwqrfyqltklldsmhdvvenllsycfqtfldksmsiefpemlaei
    itnqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mneA (A:)
    mvpaalpqltptlvslleviepevlyagpdsawrimttlnmlggrqviaavkwakaipgf
    rnlhlddqmtllqyswmslmafalgwrsyrqasgnllcfapdliineqrmtlpcmydqck
    hmlfistelqrlqvsyeeylcmktllllssvpkeglksqelfdeirmtyikelgkaivkr
    egnssqnwqrfyqltklldsmhdvvenllsycfqtfldksmsiefpemlaeiitnqipky
    sngnikkllfhqk
    

  • Chain 'B':
    No sequence available.