PDB entry 3mn7

View 3mn7 on RCSB PDB site
Description: Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
Class: Contractile Protein/Protein binding
Keywords: WH2 domain, Spire, Actin complex, Contractile Protein-Protein binding complex
Deposited on 2010-04-21, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-5C
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Act5C, CG4027
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10987 (Start-373)
      • engineered (202)
      • engineered (241)
    Domains in SCOPe 2.07: d3mn7a1, d3mn7a2
  • Chain 'S':
    Compound: Spire DDD
    Species: DROSOPHILA MELANOGASTER, synthetic [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MN7 (Start-97)
  • Heterogens: ATP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mn7A (A:)
    deevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
    rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
    imfetfntpamyvaiqavlslyasgrttgivldsgdgvshtvpiyegyalphailrldla
    grdltdylmkiltergysfttteereivrdikeklcyvaldfeqemataassssleksye
    lkdgqvitignerfrcpealfqpsflgmeacgihettynsimkcdvdirkdlyantvlsg
    gttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqe
    ydesgpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn7A (A:)
    vaalvvdngsgmckagfagddapravfpsivgrpdsyvgdeaqskrgiltlkypiehgiv
    tnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyvai
    qavlslyasgrttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkilter
    gysfttteereivrdikeklcyvaldfeqemataassssleksyelkdgqvitignerfr
    cpealfqpsflgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiadrmqke
    italapstmkikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf
    

  • Chain 'S':
    No sequence available.