PDB entry 3mn5

View 3mn5 on RCSB PDB site
Description: Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
Class: Contractile Protein/Protein binding
Keywords: WH2 domain, Spire, Actin complex, Contractile Protein-Protein binding complex
Deposited on 2010-04-21, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin, alpha skeletal muscle
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mn5a1, d3mn5a2
  • Chain 'S':
    Compound: Protein spire
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: spir, p150-Spir, CG10076
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ATP, LAB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mn5A (A:)
    dedettalvcdngsglvkagfagddapravfpsivgrvgdeaqskrgiltlkypiehgii
    tnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvai
    qavlslyasgrttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkilter
    gysfvttaereivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfr
    cpetlfqpsfigmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqke
    italapstmkikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn5A (A:)
    ttalvcdngsglvkagfagddapravfpsivgrvgdertlkypiehgiitnwddmekiwh
    htfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiqavlslyasgr
    ttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaere
    ivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfi
    gmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmki
    kiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc
    

  • Chain 'S':
    No sequence available.