PDB entry 3mn2

View 3mn2 on RCSB PDB site
Description: The crystal structure of a probable AraC family transcriptional regulator from Rhodopseudomonas palustris CGA009
Deposited on 2010-04-20, released 2010-05-12
The last revision was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable AraC family transcriptional regulator
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: RPA0567
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NCA5 (3-107)
      • expression tag (0-2)
  • Chain 'B':
    Compound: probable AraC family transcriptional regulator
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: RPA0567
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NCA5 (3-107)
      • expression tag (0-2)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mn2A (A:)
    snavrqveeyieanwmrpitiekltaltgissrgifkafqrsrgyspmafakrvrlqhah
    nllsdgatpttvtaaalscgfsnlghfardyrdmfgekpsetlqrarp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mn2B (B:)
    snavrqveeyieanwmrpitiekltaltgissrgifkafqrsrgyspmafakrvrlqhah
    nllsdgatpttvtaaalscgfsnlghfardyrdmfgekpsetlqrarp