PDB entry 3mn1

View 3mn1 on RCSB PDB site
Description: Crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NYSGRC, PHOSPHATASE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, HYDROLASE, New York SGX Research Center for Structural Genomics
Deposited on 2010-04-20, released 2010-04-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (3-180)
      • expression tag (1-2)
      • engineered (152)
      • expression tag (181-183)
    Domains in SCOPe 2.03: d3mn1a_
  • Chain 'B':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181)
    Domains in SCOPe 2.03: d3mn1b_
  • Chain 'C':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181)
    Domains in SCOPe 2.03: d3mn1c_
  • Chain 'D':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181-183)
    Domains in SCOPe 2.03: d3mn1d_
  • Chain 'E':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181)
    Domains in SCOPe 2.03: d3mn1e_
  • Chain 'F':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181-183)
    Domains in SCOPe 2.03: d3mn1f_
  • Chain 'G':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181)
    Domains in SCOPe 2.03: d3mn1g_
  • Chain 'H':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181)
    Domains in SCOPe 2.03: d3mn1h_
  • Chain 'I':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181)
    Domains in SCOPe 2.03: d3mn1i_
  • Chain 'J':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181-184)
    Domains in SCOPe 2.03: d3mn1j_
  • Chain 'K':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181-183)
    Domains in SCOPe 2.03: d3mn1k_
  • Chain 'L':
    Compound: probable yrbi family phosphatase
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:264730]
    Gene: PSPPH_4147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48EB9 (Start-180)
      • engineered (152)
      • expression tag (181)
    Domains in SCOPe 2.03: d3mn1l_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mn1A (A:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1A (A:)
    sletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlias
    gvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlp
    dlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyl
    egh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mn1B (B:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1B (B:)
    sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
    sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
    vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mn1C (C:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1C (C:)
    sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
    sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
    vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mn1D (D:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1D (D:)
    sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
    sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
    vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvylegh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mn1E (E:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1E (E:)
    sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
    sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
    vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mn1F (F:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1F (F:)
    sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
    sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
    vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvylegh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mn1G (G:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1G (G:)
    qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis
    grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv
    glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mn1H (H:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1H (H:)
    qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis
    grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv
    glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mn1I (I:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1I (I:)
    sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
    sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
    vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3mn1J (J:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1J (J:)
    qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis
    grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv
    glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyleghh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mn1K (K:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1K (K:)
    sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
    sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
    vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvylegh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mn1L (L:)
    msletetmsqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmlia
    sgvttaiisgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddl
    pdlpvirrvglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvy
    leghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mn1L (L:)
    qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis
    grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv
    glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle