PDB entry 3mmy

View 3mmy on RCSB PDB site
Description: Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1
Deposited on 2010-04-20, released 2010-06-02
The last revision was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.208
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA export factor
    Species: Homo sapiens [TaxId:9606]
    Gene: RAE1, MRNP41
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nuclear Pore Complex Protein Nup98
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP98, ADAR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: mRNA export factor
    Species: Homo sapiens [TaxId:9606]
    Gene: RAE1, MRNP41
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear Pore Complex Protein Nup98
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP98, ADAR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: mRNA export factor
    Species: Homo sapiens [TaxId:9606]
    Gene: RAE1, MRNP41
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nuclear Pore Complex Protein Nup98
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP98, ADAR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: mRNA export factor
    Species: Homo sapiens [TaxId:9606]
    Gene: RAE1, MRNP41
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Nuclear Pore Complex Protein Nup98
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP98, ADAR2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MES, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mmyA (A:)
    mslfgttsgfgtsgtsmfgsattdnhnpmkdievtsspddsigclsfspptlpgnfliag
    swandvrcwevqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqa
    iqiaqhdapvktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviy
    pmavvataerglivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrv
    aihyinppnpakdnftfkchrsngtntsapqdiyavngiafhpvhgtlatvgsdgrfsfw
    dkdartklktseqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaae
    elkprnkk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyA (A:)
    fgttsgfgtsgtsmftdnhnpmkdievtsspddsigclsfspptlpgnfliagswandvr
    cwevqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqaiqiaqhd
    apvktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviypmavvat
    aerglivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrvaihyinp
    pnpakdnftfkchrsnsapqdiyavngiafhpvhgtlatvgsdgrfsfwdkdartklkts
    eqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaaeelkpr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mmyB (B:)
    tgttikfnpptgtdtmvkagvstnistkhqcitamkeyesksleelrledyqanrk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyB (B:)
    tgttikfnpptgtdtmstnistkhqcitamkeyesksleelrledyqanrk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mmyC (C:)
    mslfgttsgfgtsgtsmfgsattdnhnpmkdievtsspddsigclsfspptlpgnfliag
    swandvrcwevqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqa
    iqiaqhdapvktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviy
    pmavvataerglivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrv
    aihyinppnpakdnftfkchrsngtntsapqdiyavngiafhpvhgtlatvgsdgrfsfw
    dkdartklktseqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaae
    elkprnkk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyC (C:)
    fsgfgtsgtsmftdnhnpmkdievtsspddsigclsfspptlpgnfliagswandvrcwe
    vqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqaiqiaqhdapv
    ktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviypmavvataer
    glivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrvaihyinppnp
    akdnftfkchrsngtntsapqdiyavngiafhpvhgtlatvgsdgrfsfwdkdartklkt
    seqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaaeelkpr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mmyD (D:)
    tgttikfnpptgtdtmvkagvstnistkhqcitamkeyesksleelrledyqanrk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyD (D:)
    tgttikfnpptgtdtmstnistkhqcitamkeyesksleelrledyqanrk
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mmyE (E:)
    mslfgttsgfgtsgtsmfgsattdnhnpmkdievtsspddsigclsfspptlpgnfliag
    swandvrcwevqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqa
    iqiaqhdapvktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviy
    pmavvataerglivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrv
    aihyinppnpakdnftfkchrsngtntsapqdiyavngiafhpvhgtlatvgsdgrfsfw
    dkdartklktseqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaae
    elkprnkk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyE (E:)
    fgttsgfgtsgtsmftdnhnpmkdievtsspddsigclsfspptlpgnfliagswandvr
    cwevqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqaiqiaqhd
    apvktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviypmavvat
    aerglivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrvaihyinp
    pnpakdnftfkchrsnsapqdiyavngiafhpvhgtlatvgsdgrfsfwdkdartklkts
    eqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaaeelkpr
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mmyF (F:)
    tgttikfnpptgtdtmvkagvstnistkhqcitamkeyesksleelrledyqanrk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyF (F:)
    tgttikfnpptgtdtmstnistkhqcitamkeyesksleelrledyqanrk
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mmyG (G:)
    mslfgttsgfgtsgtsmfgsattdnhnpmkdievtsspddsigclsfspptlpgnfliag
    swandvrcwevqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqa
    iqiaqhdapvktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviy
    pmavvataerglivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrv
    aihyinppnpakdnftfkchrsngtntsapqdiyavngiafhpvhgtlatvgsdgrfsfw
    dkdartklktseqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaae
    elkprnkk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyG (G:)
    fsgfgtsgtsmftdnhnpmkdievtsspddsigclsfspptlpgnfliagswandvrcwe
    vqdsgqtipkaqqmhtgpvldvcwsddgskvftascdktakmwdlssnqaiqiaqhdapv
    ktihwikapnyscvmtgswdktlkfwdtrssnpmmvlqlpercycadviypmavvataer
    glivyqlenqpsefrriesplkhqhrcvaifkdkqnkptgfalgsiegrvaihyinppnp
    akdnftfkchrsngtntsapqdiyavngiafhpvhgtlatvgsdgrfsfwdkdartklkt
    seqldqpisaccfnhngnifayassydwskghefynpqkknyiflrnaaeelkpr
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mmyH (H:)
    tgttikfnpptgtdtmvkagvstnistkhqcitamkeyesksleelrledyqanrk
    

    Sequence, based on observed residues (ATOM records):
    >3mmyH (H:)
    gttikfnpptgtdtmstnistkhqcitamkeyesksleelrledyqanrk