PDB entry 3mmx

View 3mmx on RCSB PDB site
Description: Bacillus anthracis NadD (baNadD) in complex with compound 1_02_3
Class: transferase
Keywords: protein-inhibitor complex, TRANSFERASE
Deposited on 2010-04-20, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.223
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxa_
  • Chain 'B':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxb_
  • Chain 'C':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxc_
  • Chain 'D':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxd_
  • Chain 'E':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxe_
  • Chain 'F':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxf_
  • Chain 'G':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxg_
  • Chain 'H':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmxh_
  • Heterogens: K, CIT, KJZ, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mmxA (A:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxA (A:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqnitsvesrlqmlelateaee
    hfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvtf
    vgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyiernglye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mmxB (B:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxB (B:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
    elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
    alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
    iernglye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mmxC (C:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxC (C:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqiitsvesrlqmlelateaee
    hfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvtf
    vgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyiernglye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mmxD (D:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxD (D:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqipnitsvesrlqmlelatea
    eehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlv
    tfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyierngl
    ye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mmxE (E:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxE (E:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqipitsvesrlqmlelateae
    ehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvt
    fvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyierngly
    e
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mmxF (F:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxF (F:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqitsvesrlqmlelateaeeh
    fsicleelssytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvtfvgvar
    pgyklrtpypittveipefavsssllrerykekktckyllpekvqvyiernglye
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mmxG (G:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxG (G:)
    rkigiiggtfdpphyghllianevyhalnleevwflpnqsvesrlqmlelateaeehfsi
    cleelssytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvtfvgvarpgy
    klrtpypittveipefavsssllrerykekktckyllpekvqvyiernglye
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mmxH (H:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmxH (H:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqiitsvesrlqmlelateaee
    hfsicleelssytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvtfvgva
    rpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyierngly