PDB entry 3mmr

View 3mmr on RCSB PDB site
Description: Structure of Plasmodium falciparum Arginase in complex with ABH
Deposited on 2010-04-20, released 2010-06-23
The last revision was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.159
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PFI0320w
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, ABH, BME, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mmrA (A:)
    mgsshhhhhhssglvprgshmasknvsiigsplaagqplggvqlacddlrklglhnvidv
    lgwkyedignidngdnemkqekktnnyinnndnnndnnndnnndnnnncyipngvikekk
    hdlsnnkmngyvnhnfygnyeennvistndkyknncyydnirnikeigifsknlfdtmsn
    elrkknfvlniggdhgvafssilsslqmyqnlrviwidahgdinipetspsgnyhgmtla
    htlglfkkkvpyfewsenltylkpentaiigirdidayekiilkkcninyytifdiekng
    iyntictalekidpnsncpihisldidsvdnvfapgtgtvakgglnyreinllmkilaet
    krvvsmdlveynpsldevdkkvhgdslpildnatktgklcleliarvlgydiv
    

    Sequence, based on observed residues (ATOM records):
    >3mmrA (A:)
    knvsiigsplaagqplggvqlacddlrklglhnvidvlgwkyedignidncyydnirnik
    eigifsknlfdtmsnelrkknfvlniggdhgvafssilsslqmyqnlrviwidahgdini
    petspsgnyhgmtlahtlglfkkkvpyfewsenltylkpentaiigirdidayekiilkk
    cninyytifdiekngiyntictalekidpnsncpihisldidsvdnvfapgtgtvakggl
    nyreinllmkilaetkrvvsmdlveynpsldevdkkvhgdslpildnatktgklclelia
    rvlgydiv