PDB entry 3mmp

View 3mmp on RCSB PDB site
Description: structure of the qb replicase, an rna-dependent rna polymerase consisting of viral and host proteins
Deposited on 2010-04-20, released 2010-06-09
The last revision was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu 2, Elongation factor Ts
    Species: Escherichia coli [TaxId:83333]
    Gene: tufB, b3980, JW3943, tsf, b0170, JW0165
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Elongation factor Tu 2, Elongation factor Ts
    Species: Escherichia coli [TaxId:83333]
    Gene: tufB, b3980, JW3943, tsf, b0170, JW0165
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: RNA-directed RNA polymerase beta chain
    Species: Enterobacteria phage Qbeta [TaxId:39803]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: RNA-directed RNA polymerase beta chain
    Species: Enterobacteria phage Qbeta [TaxId:39803]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PXN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mmpA (A:)
    maeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadg
    viktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerv
    alvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpef
    ikpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsk
    tvgqllkehnaevtgfirfevgegiekvetdfaaevaamskqshmskekfertkphvnvg
    tighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshveydtptrh
    yahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivfln
    kcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfl
    dsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstc
    tgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesevyilskde
    ggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfa
    ireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records):
    >3mmpA (A:)
    itaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgvik
    tkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeervalv
    akigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikp
    edvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvg
    qllkehnaevtgfirfevgegiekvetdfaaevaamskqskphvnvgtighvdhgkttlt
    aaittvlaktyggtshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdg
    pmpqtrehillgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpiv
    rgsalkalegdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgr
    vergiikvgeeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergq
    vlakpgtikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemv
    mpgdnikmvvtlihpiamddglrfaireggrtvgagvvakvls
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mmpC (C:)
    maeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadg
    viktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerv
    alvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpef
    ikpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsk
    tvgqllkehnaevtgfirfevgegiekvetdfaaevaamskqshmskekfertkphvnvg
    tighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshveydtptrh
    yahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivfln
    kcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfl
    dsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstc
    tgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesevyilskde
    ggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfa
    ireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records):
    >3mmpC (C:)
    itaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgvik
    tkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeervalv
    akigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikp
    edvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvg
    qllkehnaevtgfirfevgegiekvetdfaaevaamskqskphvnvgtighvdhgkttlt
    aaittvlaktyggtshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdg
    pmpqtrehillgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpiv
    rgsalkalegdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgr
    vergiikvgeeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergq
    vlakpgtikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemv
    mpgdnikmvvtlihpiamddglrfaireggrtvgagvvakvls
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mmpF (F:)
    msktassrnslsaqlrraantrievegnlalsiandlllaygqspfnseaecisfsprfd
    gtpddfrinylkaeimskyddfslgidteavawekflaaeaecaltnarlyrpdysedfn
    fslgescihmarrkiakligdvpsvegmlrhcrfsggatttnnrsyghpsfkfalpqact
    pralkyvlalrasthfdtrisdispfnkavtvpknsktdrciaiepgwnmffqlgiggil
    rdrlrcwgidlndqtinqrrahegsvtnnlatvdlsaasdsislalcelllppgwfevlm
    dlrspkgrlpdgsvvtyekissmgngytfeleslifaslarsvceildldssevtvygdd
    iilpscavpalrevfkyvgfttntkktfsegpfrescgkhyysgvdvtpfyirhrivspa
    dlilvlnnlyrwatidgvwdprahsvylkyrkllpkqlqrntipdgygdgalvgsvlinp
    faknrgwiryvpvitdhtrdreraelgsylydlfsrclsesndglplrgpsgcdsadlfa
    idqlicrsnptkisrstgkfdiqyiacssrvlapygvfqgtkvaslhea
    

    Sequence, based on observed residues (ATOM records):
    >3mmpF (F:)
    srnslsaqlrraantrievegnlalsiandlllaygqspfnseaecisfsprfdgtpddf
    rinylkaeimskyddfslgidteavawekflaaeaecaltnarlyrpfnfslgescihma
    rrkiakligdvpsvegmlrhcrfsggatttnnrsyghpsfkfalpqactpralkyvlalr
    asthfdtrisdispfnkavtvpknsktdrciaiepgwnmffqlgiggilrdrlrcwgidl
    ndqtinqrrahegsvtnnlatvdlsaasdsislalcelllppgwfevlmdlrspkgrlpd
    gsvvtyekissmgngytfeleslifaslarsvceildldssevtvygddiilpscavpal
    revfkyvgfttntkktfsegpfrescgkhyysgvdvtpfyirhrivspadlilvlnnlyr
    watidgvwdprahsvylkyrkllpkqlqrntipdgygdgalvgsvlinpfaknrgwiryv
    pvitdhtrdreraelgsylydlfsrclscdsadlfaidqlicrsnptkisrstgkfdiqy
    iacssrvla
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mmpG (G:)
    msktassrnslsaqlrraantrievegnlalsiandlllaygqspfnseaecisfsprfd
    gtpddfrinylkaeimskyddfslgidteavawekflaaeaecaltnarlyrpdysedfn
    fslgescihmarrkiakligdvpsvegmlrhcrfsggatttnnrsyghpsfkfalpqact
    pralkyvlalrasthfdtrisdispfnkavtvpknsktdrciaiepgwnmffqlgiggil
    rdrlrcwgidlndqtinqrrahegsvtnnlatvdlsaasdsislalcelllppgwfevlm
    dlrspkgrlpdgsvvtyekissmgngytfeleslifaslarsvceildldssevtvygdd
    iilpscavpalrevfkyvgfttntkktfsegpfrescgkhyysgvdvtpfyirhrivspa
    dlilvlnnlyrwatidgvwdprahsvylkyrkllpkqlqrntipdgygdgalvgsvlinp
    faknrgwiryvpvitdhtrdreraelgsylydlfsrclsesndglplrgpsgcdsadlfa
    idqlicrsnptkisrstgkfdiqyiacssrvlapygvfqgtkvaslhea
    

    Sequence, based on observed residues (ATOM records):
    >3mmpG (G:)
    srnslsaqlrraantrievegnlalsiandlllaygqspfnseaecisfsprfdgtpddf
    rinylkaeimskyddfslgidteavawekflaaeaecaltnarlyrpfnfslgescihma
    rrkiakligdvpsvegmlrhcrfsggatttnnrsyghpsfkfalpqactpralkyvlalr
    asthfdtrisdispfnkavtvpknsktdrciaiepgwnmffqlgiggilrdrlrcwgidl
    ndqtinqrrahegsvtnnlatvdlsaasdsislalcelllppgwfevlmdlrspkgrlpd
    gsvvtyekissmgngytfeleslifaslarsvceildldssevtvygddiilpscavpal
    revfkyvgfttntkktfsegpfrescgkhyysgvdvtpfyirhrivspadlilvlnnlyr
    watidgvwdprahsvylkyrkllpkqlqrntipdgygdgalvgsvlinpfaknrgwiryv
    pvitdhtrdreraelgsylydlfsrclscdsadlfaidqlicrsnptkisrstgkfdiqy
    iacssrvla