PDB entry 3mmo

View 3mmo on RCSB PDB site
Description: Structure of the Thioalkalivibrio nitratireducens cytochrome c nitrite reductase in complex with cyanide
Deposited on 2010-04-20, released 2010-09-29
The last revision was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.149
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eight-heme nitrite reductase
    Species: Thioalkalivibrio nitratireducens [TaxId:186931]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Eight-heme nitrite reductase
    Species: Thioalkalivibrio nitratireducens [TaxId:186931]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEC, CYN, CA, PG6, PG4, TRS, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mmoA (A:)
    epgenlkpvdamqcfdchtqiedmhtvgkhatvncvhchdatehvetassrrmgerpvtr
    mdleacatchtaqfnsfvevrheshprlekatptsrspmfdkliaghgfafehaeprsha
    fmlvdhfvvdrayggrfqfknwqkvtdgmgavrgawtvltdadpessdqrrflsqtataa
    npvclncktqdhildwaymgdeheaakwsrtsevvefardlnhplncfmchdphsagprv
    vrdglinavvdrglgtyphdpvkseqqgmtkvtfqrgredfraiglldtadsnvmcaqch
    veyncnpgyqlsdgsrvgmddrranhffwanvfdykeaaqeidffdfrhattgaalpklq
    hpeaetfwgsvherngvacadchmpkvqlengkvytshsqrtprdmmgqaclnchaewte
    dqalyaidyiknythgkivkseywlakmidlfpvakragvsedvlnqarelhydahlywe
    wwtaensvgfhnpdqareslmtsiskskeavsllndaidaqvasr
    

    Sequence, based on observed residues (ATOM records):
    >3mmoA (A:)
    nlkpvdamqcfdchtqiedmhtvgkhatvncvhchdatehvetassrrmgerpvtrmdle
    acatchtaqfnsfvevrheshprlekatptsrspmfdkliaghgfafehaeprshafmlv
    dhfvvdrayggrfqfknwqkvtdgmgavrgawtvltdadpessdqrrflsqtataanpvc
    lncktqdhildwaymgdeheaakwsrtsevvefardlnhplncfmchdphsagprvvrdg
    linavvdrglgtyphdpvkseqqgmtkvtfqrgredfraiglldtadsnvmcaqchveyn
    cnpgyqlsdgsrvgmddrranhffwanvfdykeaaqeidffdfrhattgaalpklqhpea
    etfwgsvherngvacadchmpkvqlengkvytshsqrtprdmmgqaclnchaewtedqal
    yaidyiknythgkivkseywlakmidlfpvakragvsedvlnqarelhydahlywewwta
    ensvgfhnpdqareslmtsiskskeavsllndaidaqv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mmoB (B:)
    epgenlkpvdamqcfdchtqiedmhtvgkhatvncvhchdatehvetassrrmgerpvtr
    mdleacatchtaqfnsfvevrheshprlekatptsrspmfdkliaghgfafehaeprsha
    fmlvdhfvvdrayggrfqfknwqkvtdgmgavrgawtvltdadpessdqrrflsqtataa
    npvclncktqdhildwaymgdeheaakwsrtsevvefardlnhplncfmchdphsagprv
    vrdglinavvdrglgtyphdpvkseqqgmtkvtfqrgredfraiglldtadsnvmcaqch
    veyncnpgyqlsdgsrvgmddrranhffwanvfdykeaaqeidffdfrhattgaalpklq
    hpeaetfwgsvherngvacadchmpkvqlengkvytshsqrtprdmmgqaclnchaewte
    dqalyaidyiknythgkivkseywlakmidlfpvakragvsedvlnqarelhydahlywe
    wwtaensvgfhnpdqareslmtsiskskeavsllndaidaqvasr
    

    Sequence, based on observed residues (ATOM records):
    >3mmoB (B:)
    nlkpvdamqcfdchtqiedmhtvgkhatvncvhchdatehvetassrrmgerpvtrmdle
    acatchtaqfnsfvevrheshprlekatptsrspmfdkliaghgfafehaeprshafmlv
    dhfvvdrayggrfqfknwqkvtdgmgavrgawtvltdadpessdqrrflsqtataanpvc
    lncktqdhildwaymgdeheaakwsrtsevvefardlnhplncfmchdphsagprvvrdg
    linavvdrglgtyphdpvkseqqgmtkvtfqrgredfraiglldtadsnvmcaqchveyn
    cnpgyqlsdgsrvgmddrranhffwanvfdykeaaqeidffdfrhattgaalpklqhpea
    etfwgsvherngvacadchmpkvqlengkvytshsqrtprdmmgqaclnchaewtedqal
    yaidyiknythgkivkseywlakmidlfpvakragvsedvlnqarelhydahlywewwta
    ensvgfhnpdqareslmtsiskskeavsllndaidaqv