PDB entry 3mmn

View 3mmn on RCSB PDB site
Description: Crystal structure of the receiver domain of the histidine kinase CKI1 from Arabidopsis thaliana complexed with Mg2+
Deposited on 2010-04-20, released 2011-04-13
The last revision was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine kinase homolog
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: cki1, At2g47430
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22267
      • expression tag (10-14)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mmnA (A:)
    gsshhhhhhssglvprgshmastdsesetrvksvrtgrkpignpedeqetskpsddeflr
    gkrvlvvddnfisrkvatgklkkmgvseveqcdsgkealrlvtegltqreeqgsvdklpf
    dyifmdcqmpemdgyeatreirkveksygvrtpiiavsghdpgseearetiqagmdafld
    kslnqlanvireieskrhlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mmnA (A:)
    sglvpddeflrgkrvlvvddnfisrkvatgklkkmgvseveqcdsgkealrlvtegltqr
    eeqgsvdklpfdyifmdcqmpemdgyeatreirkveksygvrtpiiavsghdpgseeare
    tiqagmdafldkslnqlanvireie