PDB entry 3mmk

View 3mmk on RCSB PDB site
Description: the structural basis for partial redundancy in a class of transcription factors, the lim-homeodomain proteins, in neural cell type specification
Deposited on 2010-04-20, released 2011-07-13
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion of LIM/homeobox protein Lhx4, linker, Insulin gene enhancer protein ISL-2
    Species: Mus musculus [TaxId:10090]
    Gene: Gsh-4, Gsh4, Isl2, Lhx4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53776
    • PDB 3MMK (Start-138)
    • Uniprot Q9CXV0 (139-End)
  • Chain 'B':
    Compound: Fusion of LIM/homeobox protein Lhx4, linker, Insulin gene enhancer protein ISL-2
    Species: Mus musculus [TaxId:10090]
    Gene: Gsh-4, Gsh4, Isl2, Lhx4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53776
    • PDB 3MMK (Start-138)
    • Uniprot Q9CXV0 (139-168)
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mmkA (A:)
    gsmqqipqcagcnqhildkfilkvldrhwhssclkcadcqmqladrcfsragsvyckedf
    fkrfgtkctacqqgipptqvvrkaqdfvyhlhcfaciicnrqlatgdefylmedgrlvck
    edyetakqggsgghmgsgggtplvagspighenavqgsavevqtyqppw
    

    Sequence, based on observed residues (ATOM records):
    >3mmkA (A:)
    qipqcagcnqhildkfilkvldrhwhssclkcadcqmqladrcfsragsvyckedffkrf
    gtkctacqqgitqvvrkaqdfvyhlhcfaciicnrqlatgdefylmedgrlvckedyeta
    kgggtplvagspighenavqgsavevqtyqp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mmkB (B:)
    gsmqqipqcagcnqhildkfilkvldrhwhssclkcadcqmqladrcfsragsvyckedf
    fkrfgtkctacqqgipptqvvrkaqdfvyhlhcfaciicnrqlatgdefylmedgrlvck
    edyetakqggsgghmgsgggtplvagspighenavqgsavevqtyqppw
    

    Sequence, based on observed residues (ATOM records):
    >3mmkB (B:)
    qipqcagcnqhildkfilkvldrhwhssclkcadcqmqladrcfsragsvyckedffkrf
    gtkctacqqgipptqvvrkaqdfvyhlhcfaciicnrqlatgdefylmedgrlvckedye
    takggtplvagspighenavqgsavevqtyqppw