PDB entry 3mmj

View 3mmj on RCSB PDB site
Description: Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Class: hydrolase
Keywords: phytase, protein tyrosine phosphatase, inositol phosphate, inositol phosphatase, HYDROLASE
Deposited on 2010-04-20, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myo-inositol hexaphosphate phosphohydrolase
    Species: Selenomonas ruminantium [TaxId:971]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WUJ1 (0-313)
      • engineered (219)
    Domains in SCOPe 2.07: d3mmja_
  • Chain 'B':
    Compound: myo-inositol hexaphosphate phosphohydrolase
    Species: Selenomonas ruminantium [TaxId:971]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WUJ1 (Start-313)
      • engineered (219)
    Domains in SCOPe 2.07: d3mmjb_
  • Heterogens: IHP, PO4, ACT, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mmjA (A:)
    qtvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvp
    sregmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswyger
    dwanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaa
    gmryfriaatdhvwptpenidrflafyrtlpqdawlhfhseagvgrttafmvmtdmlknp
    svslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyq
    tpwsvwlkshpaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mmjB (B:)
    qtvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvp
    sregmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswyger
    dwanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaa
    gmryfriaatdhvwptpenidrflafyrtlpqdawlhfhseagvgrttafmvmtdmlknp
    svslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyq
    tpwsvwlkshpaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmjB (B:)
    tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
    regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
    wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
    mryfriaatdhvwptpenidrflafyrtlpqdawlhfhseagvgrttafmvmtdmlknps
    vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
    pwsvwlkshpaka