PDB entry 3mmh

View 3mmh on RCSB PDB site
Description: X-ray structure of free methionine-R-sulfoxide reductase from neisseria meningitidis in complex with its substrate
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2010-04-19, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.12
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine-R-sulfoxide reductase
    Species: Neisseria meningitidis [TaxId:604162]
    Gene: CAX50842, NMV_2074
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmha_
  • Chain 'B':
    Compound: Methionine-R-sulfoxide reductase
    Species: Neisseria meningitidis [TaxId:604162]
    Gene: CAX50842, NMV_2074
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmhb_
  • Heterogens: SME, MG, MRD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mmhA (A:)
    mhalhfsasdkaalyrevlpqiesvvadetdwvanlantaavlkeafgwfwvgfylvdtr
    sdelvlapfqgplactripfgrgvcgqawakggtvvvgdvdahpdhiacsslsrseivvp
    lfsdgrcigvldadsehlaqfdetdalylgelakilekrfeasrqav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mmhB (B:)
    mhalhfsasdkaalyrevlpqiesvvadetdwvanlantaavlkeafgwfwvgfylvdtr
    sdelvlapfqgplactripfgrgvcgqawakggtvvvgdvdahpdhiacsslsrseivvp
    lfsdgrcigvldadsehlaqfdetdalylgelakilekrfeasrqav