PDB entry 3mmg

View 3mmg on RCSB PDB site
Description: Crystal structure of tobacco vein mottling virus protease
Class: viral protein, hydrolase
Keywords: 3C-type protease, TEV, TVMV, VIRAL PROTEIN, HYDROLASE
Deposited on 2010-04-19, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear inclusion protein A
    Species: Tobacco vein mottling virus [TaxId:12228]
    Gene: PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J0W2 (0-End)
      • engineered mutation (64)
      • engineered mutation (66)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d3mmga_
  • Chain 'B':
    Compound: Nuclear inclusion protein A
    Species: Tobacco vein mottling virus [TaxId:12228]
    Gene: PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9J0W2
      • engineered mutation (64)
      • engineered mutation (66)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d3mmgb_
  • Chain 'C':
    Compound: Nuclear inclusion protein B fragment
    Species: Tobacco vein mottling virus, synthetic [TaxId:12228]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MMG (0-End)
  • Chain 'D':
    Compound: Nuclear inclusion protein B fragment
    Species: Tobacco vein mottling virus, synthetic [TaxId:12228]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MMG (0-7)
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mmgA (A:)
    skallkgvrdfnpisacvcllenssdghserlfgigfgpyiianqhlfrrnngeltiktm
    hgefavanstqlqmkpvegrdiivikmakdfppfpqklkfrqptikdrvcmvstnfqqks
    vsslvsesshivhkedtsfwqhwittkdgqagsplvsiidgnilgihslthttngsnyfv
    efpekfvatyldaadgwcknwkfnadkiswgsftlvedapeddfmakktvaaimddlvrt
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmgA (A:)
    skallkgvrdfnpisacvcllenssdghserlfgigfgpyiianqhlfrrnngeltiktm
    hgefavanstqlqmkpvegrdiivikmakdfppfpqklkfrqptikdrvcmvstnfqqks
    vsslvsesshivhkedtsfwqhwittkdgqagsplvsiidgnilgihslthttngsnyfv
    efpekfvatyldaadgwcknwkfnadkiswgsftlve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mmgB (B:)
    skallkgvrdfnpisacvcllenssdghserlfgigfgpyiianqhlfrrnngeltiktm
    hgefavanstqlqmkpvegrdiivikmakdfppfpqklkfrqptikdrvcmvstnfqqks
    vsslvsesshivhkedtsfwqhwittkdgqagsplvsiidgnilgihslthttngsnyfv
    efpekfvatyldaadgwcknwkfnadkiswgsftlvedapeddfmakktvaaimddlvrt
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmgB (B:)
    allkgvrdfnpisacvcllenssdghserlfgigfgpyiianqhlfrrnngeltiktmhg
    efavanstqlqmkpvegrdiivikmakdfppfpqklkfrqptikdrvcmvstnfqqksvs
    slvsesshivhkedtsfwqhwittkdgqagsplvsiidgnilgihslthttngsnyfvef
    pekfvatyldaadgwcknwkfnadkiswgsftlv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.