PDB entry 3mmd

View 3mmd on RCSB PDB site
Description: Crystal structure of the W241A mutant of xylanase from Geobacillus stearothermophilus T-6 (XT6) complexed with hydrolyzed xylopentaose
Class: hydrolase
Keywords: Xylanase, mutagenesis, HYDROLASE
Deposited on 2010-04-19, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.214
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40943 (Start-378)
      • engineered (240)
    Domains in SCOPe 2.07: d3mmda_
  • Heterogens: ZN, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mmdA (A:)
    knadsyakkphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenv
    mkpisiqpeegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnet
    dpvkreqnkqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidy
    ikvafqaarkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqig
    apseaeiektinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlf
    klyeklsdkisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapf
    vfgpdykvkpaywaiidhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmdA (A:)
    kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
    eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
    kqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikvafqaa
    rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigapseaeie
    ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
    kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
    kpaywaiidhk