PDB entry 3mmc

View 3mmc on RCSB PDB site
Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
Class: oxidoreductase
Keywords: alpha-beta-protein, OXIDOREDUCTASE
Deposited on 2010-04-19, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite reductase, dissimilatory-type subunit alpha
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmca1, d3mmca2, d3mmca3
  • Chain 'B':
    Compound: sulfite reductase, dissimilatory-type subunit beta
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmcb1, d3mmcb2, d3mmcb3
  • Chain 'D':
    Compound: sulfite reductase, dissimilatory-type subunit alpha
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmcd1, d3mmcd2, d3mmcd3
  • Chain 'E':
    Compound: sulfite reductase, dissimilatory-type subunit beta
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mmce1, d3mmce2, d3mmce3
  • Heterogens: SRM, SF4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mmcA (A:)
    msetplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkk
    thwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvw
    ekwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpa
    lcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwk
    ddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkal
    kpgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfre
    rigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmcA (A:)
    setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
    hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
    kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpal
    cefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwkd
    dikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkalk
    pgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfrer
    igeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mmcB (B:)
    mvvegvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtpr
    llsiytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwd
    avkgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccan
    mcgavhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvek
    cmycgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlv
    kyvkqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefra
    stqfkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmcB (B:)
    egvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtprlls
    iytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwdavk
    geyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmcg
    avhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvekcmy
    cgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyv
    kqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastq
    fkw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mmcD (D:)
    msetplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkk
    thwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvw
    ekwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpa
    lcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwk
    ddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkal
    kpgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfre
    rigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmcD (D:)
    setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
    hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
    kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpal
    cefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwkd
    dikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkalk
    pgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfrer
    igeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mmcE (E:)
    mvvegvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtpr
    llsiytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwd
    avkgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccan
    mcgavhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvek
    cmycgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlv
    kyvkqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefra
    stqfkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mmcE (E:)
    egvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtprlls
    iytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwdavk
    geyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmcg
    avhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvekcmy
    cgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyv
    kqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastq
    fkw