PDB entry 3mm5

View 3mm5 on RCSB PDB site
Description: Dissimilatory sulfite reductase in complex with the substrate sulfite
Class: oxidoreductase
Keywords: alpha-beta-protein, OXIDOREDUCTASE
Deposited on 2010-04-19, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite reductase, dissimilatory-type subunit alpha
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mm5a1, d3mm5a2, d3mm5a3
  • Chain 'B':
    Compound: sulfite reductase, dissimilatory-type subunit beta
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mm5b1, d3mm5b2, d3mm5b3
  • Chain 'D':
    Compound: sulfite reductase, dissimilatory-type subunit alpha
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mm5d1, d3mm5d2, d3mm5d3
  • Chain 'E':
    Compound: sulfite reductase, dissimilatory-type subunit beta
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mm5e1, d3mm5e2, d3mm5e3
  • Heterogens: SRM, SF4, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mm5A (A:)
    msetplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkk
    thwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvw
    ekwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpa
    lcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwk
    ddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkal
    kpgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfre
    rigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm5A (A:)
    setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
    hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
    kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpal
    cefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwkd
    dikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkalk
    pgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfrer
    igeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mm5B (B:)
    mvvegvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtpr
    llsiytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwd
    avkgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccan
    mcgavhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvek
    cmycgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlv
    kyvkqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefra
    stqfkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm5B (B:)
    egvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtprlls
    iytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwdavk
    geyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmcg
    avhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvekcmy
    cgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyv
    kqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastq
    fkw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mm5D (D:)
    msetplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkk
    thwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvw
    ekwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpa
    lcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwk
    ddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkal
    kpgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfre
    rigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm5D (D:)
    setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
    hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
    kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsgsdlrtpsacmgpal
    cefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvaskarsdfaiigtwkd
    dikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpkalk
    pgdergatiliggkapfvegavigwvavpfvevekpydeikeileaiwdwwdeegkfrer
    igeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteelkkrgmw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mm5E (E:)
    mvvegvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtpr
    llsiytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwd
    avkgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccan
    mcgavhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvek
    cmycgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlv
    kyvkqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefra
    stqfkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm5E (E:)
    egvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtprlls
    iytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwdavk
    geyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmcg
    avhasdiaivgihrtppipndeairktceipstvaacptgalkpdmknktikvdvekcmy
    cgncytmcpgmplfdpendgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyv
    kqileawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastq
    fkw