PDB entry 3mm3

View 3mm3 on RCSB PDB site
Description: Dye-decolorizing peroxidase (DyP) D171N in complex with cyanide
Class: oxidoreductase
Keywords: DyP, Dye-decolorizing peroxidase, beta barrel, aspartic acid, OXIDOREDUCTASE
Deposited on 2010-04-19, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DyP
    Species: Bjerkandera adusta [TaxId:5331]
    Gene: dyp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZK8 (Start-441)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d3mm3a_
  • Heterogens: HEM, CYN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mm3A (A:)
    andtilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdps
    qqplafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgv
    fligsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgflngisqpsvtg
    wettvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaip
    ansagnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltde
    trcpfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyq
    siigngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfv
    ipkggeyfflpsisaltatiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm3A (A:)
    tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
    lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
    gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgflngisqpsvtgwet
    tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
    agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
    pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
    gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
    ggeyfflpsisaltatiaa